Pongo pygmaeus (Bornean orangutan): 129012457 Help Entry 129012457         CDS       T10128                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04014   Ras signaling pathway ppyg04015   Rap1 signaling pathway ppyg04020   Calcium signaling pathway ppyg04022   cGMP-PKG signaling pathway ppyg04024   cAMP signaling pathway ppyg04070   Phosphatidylinositol signaling system ppyg04114   Oocyte meiosis ppyg04218   Cellular senescence ppyg04261   Adrenergic signaling in cardiomyocytes ppyg04270   Vascular smooth muscle contraction ppyg04371   Apelin signaling pathway ppyg04625   C-type lectin receptor signaling pathway ppyg04713   Circadian entrainment ppyg04720   Long-term potentiation ppyg04722   Neurotrophin signaling pathway ppyg04728   Dopaminergic synapse ppyg04740   Olfactory transduction ppyg04744   Phototransduction ppyg04750   Inflammatory mediator regulation of TRP channels ppyg04910   Insulin signaling pathway ppyg04912   GnRH signaling pathway ppyg04915   Estrogen signaling pathway ppyg04916   Melanogenesis ppyg04921   Oxytocin signaling pathway ppyg04922   Glucagon signaling pathway ppyg04924   Renin secretion ppyg04925   Aldosterone synthesis and secretion ppyg04970   Salivary secretion ppyg04971   Gastric acid secretion ppyg05010   Alzheimer disease ppyg05012   Parkinson disease ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05031   Amphetamine addiction ppyg05034   Alcoholism ppyg05133   Pertussis ppyg05152   Tuberculosis ppyg05163   Human cytomegalovirus infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05200   Pathways in cancer ppyg05214   Glioma ppyg05417   Lipid and atherosclerosis ppyg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129012457    04015 Rap1 signaling pathway     129012457    04371 Apelin signaling pathway     129012457    04020 Calcium signaling pathway     129012457    04070 Phosphatidylinositol signaling system     129012457    04024 cAMP signaling pathway     129012457    04022 cGMP-PKG signaling pathway     129012457  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129012457    04218 Cellular senescence     129012457  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129012457   09152 Endocrine system    04910 Insulin signaling pathway     129012457    04922 Glucagon signaling pathway     129012457    04912 GnRH signaling pathway     129012457    04915 Estrogen signaling pathway     129012457    04921 Oxytocin signaling pathway     129012457    04916 Melanogenesis     129012457    04924 Renin secretion     129012457    04925 Aldosterone synthesis and secretion     129012457   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129012457    04270 Vascular smooth muscle contraction     129012457   09154 Digestive system    04970 Salivary secretion     129012457    04971 Gastric acid secretion     129012457   09156 Nervous system    04728 Dopaminergic synapse     129012457    04720 Long-term potentiation     129012457    04722 Neurotrophin signaling pathway     129012457   09157 Sensory system    04744 Phototransduction     129012457    04740 Olfactory transduction     129012457    04750 Inflammatory mediator regulation of TRP channels     129012457   09159 Environmental adaptation    04713 Circadian entrainment     129012457  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129012457   09162 Cancer: specific types    05214 Glioma     129012457   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129012457    05163 Human cytomegalovirus infection     129012457    05167 Kaposi sarcoma-associated herpesvirus infection     129012457   09171 Infectious disease: bacterial    05133 Pertussis     129012457    05152 Tuberculosis     129012457   09164 Neurodegenerative disease    05010 Alzheimer disease     129012457    05012 Parkinson disease     129012457    05022 Pathways of neurodegeneration - multiple diseases     129012457   09165 Substance dependence    05031 Amphetamine addiction     129012457    05034 Alcoholism     129012457   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129012457    05418 Fluid shear stress and atherosclerosis     129012457  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppyg01009]     129012457   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129012457    03036 Chromosome and associated proteins [BR:ppyg03036]     129012457   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129012457 Protein phosphatases and associated proteins [BR:ppyg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129012457 Membrane trafficking [BR:ppyg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129012457 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129012457 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129012457 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 AIF-1 EF-hand_9 EF-hand_5 EH EF-hand_11 TerB SPEF2_C EF_EFCAB10_C DUF1103 Herpes_UL36 Phage_TAC_12 Retrotrans_gag Ku_PK_bind DUF6802 Motif Other DBs NCBI-GeneID:  129012457 NCBI-ProteinID:  XP_063507950 LinkDB All DBs Position 15:74883976..74887527 Genome browser AA seq 173 aa AA seqDB search MLGQLTEEQISEFKEAFSLFEKDGDGTITTKELGTAMTSFGQNPTEAELQDMISELDADG NSTVDFREFLTMTARKIKDTDSEEEIRDAFSVFEQDGHGSISAAEFHHLMTNLGEKLTDE EVDEIIREADTDSDGQVNYEEFIQMMTAKRRPCTEYVKFLVQNSYLPFLLTYL NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgcttggccaactgactgaagagcagatttcagaattcaaagaagctttttcactattt gaaaaagatggtgatggaactataacaaccaaagaattgggaactgcaatgacgtctttt gggcagaatcccacagaagcagagttacaggacatgattagtgaattagatgccgatggt aatagcacagttgacttccgagaatttctgacaatgacggcaagaaaaataaaagacaca gacagtgaagaagaaattagagatgcattcagtgtgtttgagcaggatggccatggttct attagtgctgcagaatttcaccatctgatgacaaaccttggagagaagttaacagatgaa gaagttgatgaaataatcagggaagcagatactgatagtgatggtcaagtaaactatgaa gagtttatacagatgatgacagcaaagcgaagaccttgtacagaatatgttaaatttctt gtacaaaatagttacttgccttttcttttaacttatctgtga

DBGET integrated database retrieval system