KEGG   Pongo pygmaeus (Bornean orangutan): 129015849
Entry
129015849         CDS       T10128                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ppyg  Pongo pygmaeus (Bornean orangutan)
Pathway
ppyg01521  EGFR tyrosine kinase inhibitor resistance
ppyg01522  Endocrine resistance
ppyg01524  Platinum drug resistance
ppyg04010  MAPK signaling pathway
ppyg04012  ErbB signaling pathway
ppyg04014  Ras signaling pathway
ppyg04015  Rap1 signaling pathway
ppyg04022  cGMP-PKG signaling pathway
ppyg04024  cAMP signaling pathway
ppyg04062  Chemokine signaling pathway
ppyg04066  HIF-1 signaling pathway
ppyg04068  FoxO signaling pathway
ppyg04071  Sphingolipid signaling pathway
ppyg04072  Phospholipase D signaling pathway
ppyg04114  Oocyte meiosis
ppyg04140  Autophagy - animal
ppyg04148  Efferocytosis
ppyg04150  mTOR signaling pathway
ppyg04151  PI3K-Akt signaling pathway
ppyg04210  Apoptosis
ppyg04218  Cellular senescence
ppyg04261  Adrenergic signaling in cardiomyocytes
ppyg04270  Vascular smooth muscle contraction
ppyg04350  TGF-beta signaling pathway
ppyg04360  Axon guidance
ppyg04370  VEGF signaling pathway
ppyg04371  Apelin signaling pathway
ppyg04380  Osteoclast differentiation
ppyg04510  Focal adhesion
ppyg04517  IgSF CAM signaling
ppyg04520  Adherens junction
ppyg04540  Gap junction
ppyg04550  Signaling pathways regulating pluripotency of stem cells
ppyg04611  Platelet activation
ppyg04613  Neutrophil extracellular trap formation
ppyg04620  Toll-like receptor signaling pathway
ppyg04621  NOD-like receptor signaling pathway
ppyg04625  C-type lectin receptor signaling pathway
ppyg04650  Natural killer cell mediated cytotoxicity
ppyg04657  IL-17 signaling pathway
ppyg04658  Th1 and Th2 cell differentiation
ppyg04659  Th17 cell differentiation
ppyg04660  T cell receptor signaling pathway
ppyg04662  B cell receptor signaling pathway
ppyg04664  Fc epsilon RI signaling pathway
ppyg04666  Fc gamma R-mediated phagocytosis
ppyg04668  TNF signaling pathway
ppyg04713  Circadian entrainment
ppyg04720  Long-term potentiation
ppyg04722  Neurotrophin signaling pathway
ppyg04723  Retrograde endocannabinoid signaling
ppyg04724  Glutamatergic synapse
ppyg04725  Cholinergic synapse
ppyg04726  Serotonergic synapse
ppyg04730  Long-term depression
ppyg04810  Regulation of actin cytoskeleton
ppyg04910  Insulin signaling pathway
ppyg04912  GnRH signaling pathway
ppyg04914  Progesterone-mediated oocyte maturation
ppyg04915  Estrogen signaling pathway
ppyg04916  Melanogenesis
ppyg04917  Prolactin signaling pathway
ppyg04919  Thyroid hormone signaling pathway
ppyg04921  Oxytocin signaling pathway
ppyg04926  Relaxin signaling pathway
ppyg04928  Parathyroid hormone synthesis, secretion and action
ppyg04929  GnRH secretion
ppyg04930  Type II diabetes mellitus
ppyg04933  AGE-RAGE signaling pathway in diabetic complications
ppyg04934  Cushing syndrome
ppyg04935  Growth hormone synthesis, secretion and action
ppyg04960  Aldosterone-regulated sodium reabsorption
ppyg05010  Alzheimer disease
ppyg05020  Prion disease
ppyg05022  Pathways of neurodegeneration - multiple diseases
ppyg05034  Alcoholism
ppyg05132  Salmonella infection
ppyg05133  Pertussis
ppyg05135  Yersinia infection
ppyg05140  Leishmaniasis
ppyg05142  Chagas disease
ppyg05145  Toxoplasmosis
ppyg05152  Tuberculosis
ppyg05160  Hepatitis C
ppyg05161  Hepatitis B
ppyg05163  Human cytomegalovirus infection
ppyg05164  Influenza A
ppyg05165  Human papillomavirus infection
ppyg05166  Human T-cell leukemia virus 1 infection
ppyg05167  Kaposi sarcoma-associated herpesvirus infection
ppyg05170  Human immunodeficiency virus 1 infection
ppyg05171  Coronavirus disease - COVID-19
ppyg05200  Pathways in cancer
ppyg05203  Viral carcinogenesis
ppyg05205  Proteoglycans in cancer
ppyg05206  MicroRNAs in cancer
ppyg05207  Chemical carcinogenesis - receptor activation
ppyg05208  Chemical carcinogenesis - reactive oxygen species
ppyg05210  Colorectal cancer
ppyg05211  Renal cell carcinoma
ppyg05212  Pancreatic cancer
ppyg05213  Endometrial cancer
ppyg05214  Glioma
ppyg05215  Prostate cancer
ppyg05216  Thyroid cancer
ppyg05218  Melanoma
ppyg05219  Bladder cancer
ppyg05220  Chronic myeloid leukemia
ppyg05221  Acute myeloid leukemia
ppyg05223  Non-small cell lung cancer
ppyg05224  Breast cancer
ppyg05225  Hepatocellular carcinoma
ppyg05226  Gastric cancer
ppyg05230  Central carbon metabolism in cancer
ppyg05231  Choline metabolism in cancer
ppyg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ppyg05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ppyg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    129015849 (MAPK3)
   04012 ErbB signaling pathway
    129015849 (MAPK3)
   04014 Ras signaling pathway
    129015849 (MAPK3)
   04015 Rap1 signaling pathway
    129015849 (MAPK3)
   04350 TGF-beta signaling pathway
    129015849 (MAPK3)
   04370 VEGF signaling pathway
    129015849 (MAPK3)
   04371 Apelin signaling pathway
    129015849 (MAPK3)
   04668 TNF signaling pathway
    129015849 (MAPK3)
   04066 HIF-1 signaling pathway
    129015849 (MAPK3)
   04068 FoxO signaling pathway
    129015849 (MAPK3)
   04072 Phospholipase D signaling pathway
    129015849 (MAPK3)
   04071 Sphingolipid signaling pathway
    129015849 (MAPK3)
   04024 cAMP signaling pathway
    129015849 (MAPK3)
   04022 cGMP-PKG signaling pathway
    129015849 (MAPK3)
   04151 PI3K-Akt signaling pathway
    129015849 (MAPK3)
   04150 mTOR signaling pathway
    129015849 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    129015849 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    129015849 (MAPK3)
   04148 Efferocytosis
    129015849 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    129015849 (MAPK3)
   04210 Apoptosis
    129015849 (MAPK3)
   04218 Cellular senescence
    129015849 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    129015849 (MAPK3)
   04520 Adherens junction
    129015849 (MAPK3)
   04540 Gap junction
    129015849 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    129015849 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    129015849 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    129015849 (MAPK3)
   04613 Neutrophil extracellular trap formation
    129015849 (MAPK3)
   04620 Toll-like receptor signaling pathway
    129015849 (MAPK3)
   04621 NOD-like receptor signaling pathway
    129015849 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    129015849 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    129015849 (MAPK3)
   04660 T cell receptor signaling pathway
    129015849 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    129015849 (MAPK3)
   04659 Th17 cell differentiation
    129015849 (MAPK3)
   04657 IL-17 signaling pathway
    129015849 (MAPK3)
   04662 B cell receptor signaling pathway
    129015849 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    129015849 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    129015849 (MAPK3)
   04062 Chemokine signaling pathway
    129015849 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    129015849 (MAPK3)
   04929 GnRH secretion
    129015849 (MAPK3)
   04912 GnRH signaling pathway
    129015849 (MAPK3)
   04915 Estrogen signaling pathway
    129015849 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    129015849 (MAPK3)
   04917 Prolactin signaling pathway
    129015849 (MAPK3)
   04921 Oxytocin signaling pathway
    129015849 (MAPK3)
   04926 Relaxin signaling pathway
    129015849 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    129015849 (MAPK3)
   04919 Thyroid hormone signaling pathway
    129015849 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    129015849 (MAPK3)
   04916 Melanogenesis
    129015849 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    129015849 (MAPK3)
   04270 Vascular smooth muscle contraction
    129015849 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    129015849 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    129015849 (MAPK3)
   04725 Cholinergic synapse
    129015849 (MAPK3)
   04726 Serotonergic synapse
    129015849 (MAPK3)
   04720 Long-term potentiation
    129015849 (MAPK3)
   04730 Long-term depression
    129015849 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    129015849 (MAPK3)
   04722 Neurotrophin signaling pathway
    129015849 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    129015849 (MAPK3)
   04380 Osteoclast differentiation
    129015849 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    129015849 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    129015849 (MAPK3)
   05206 MicroRNAs in cancer
    129015849 (MAPK3)
   05205 Proteoglycans in cancer
    129015849 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    129015849 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    129015849 (MAPK3)
   05203 Viral carcinogenesis
    129015849 (MAPK3)
   05230 Central carbon metabolism in cancer
    129015849 (MAPK3)
   05231 Choline metabolism in cancer
    129015849 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    129015849 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    129015849 (MAPK3)
   05212 Pancreatic cancer
    129015849 (MAPK3)
   05225 Hepatocellular carcinoma
    129015849 (MAPK3)
   05226 Gastric cancer
    129015849 (MAPK3)
   05214 Glioma
    129015849 (MAPK3)
   05216 Thyroid cancer
    129015849 (MAPK3)
   05221 Acute myeloid leukemia
    129015849 (MAPK3)
   05220 Chronic myeloid leukemia
    129015849 (MAPK3)
   05218 Melanoma
    129015849 (MAPK3)
   05211 Renal cell carcinoma
    129015849 (MAPK3)
   05219 Bladder cancer
    129015849 (MAPK3)
   05215 Prostate cancer
    129015849 (MAPK3)
   05213 Endometrial cancer
    129015849 (MAPK3)
   05224 Breast cancer
    129015849 (MAPK3)
   05223 Non-small cell lung cancer
    129015849 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    129015849 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    129015849 (MAPK3)
   05161 Hepatitis B
    129015849 (MAPK3)
   05160 Hepatitis C
    129015849 (MAPK3)
   05171 Coronavirus disease - COVID-19
    129015849 (MAPK3)
   05164 Influenza A
    129015849 (MAPK3)
   05163 Human cytomegalovirus infection
    129015849 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    129015849 (MAPK3)
   05165 Human papillomavirus infection
    129015849 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    129015849 (MAPK3)
   05135 Yersinia infection
    129015849 (MAPK3)
   05133 Pertussis
    129015849 (MAPK3)
   05152 Tuberculosis
    129015849 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    129015849 (MAPK3)
   05140 Leishmaniasis
    129015849 (MAPK3)
   05142 Chagas disease
    129015849 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    129015849 (MAPK3)
   05020 Prion disease
    129015849 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    129015849 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    129015849 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    129015849 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    129015849 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    129015849 (MAPK3)
   04934 Cushing syndrome
    129015849 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    129015849 (MAPK3)
   01524 Platinum drug resistance
    129015849 (MAPK3)
   01522 Endocrine resistance
    129015849 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ppyg01001]
    129015849 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppyg03036]
    129015849 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppyg04147]
    129015849 (MAPK3)
Enzymes [BR:ppyg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     129015849 (MAPK3)
Protein kinases [BR:ppyg01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   129015849 (MAPK3)
Chromosome and associated proteins [BR:ppyg03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     129015849 (MAPK3)
Exosome [BR:ppyg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   129015849 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 129015849
NCBI-ProteinID: XP_054310460
LinkDB
Position
18:31567066..31576160
AA seq 382 aa
MAAAAAAAAQGGGGGEPRRTEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVS
SAYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRD
VYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTT
CDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAE
MLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFP
KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPK
ERLKELIFQETARFQPGVLEAP
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggctcaggggggcgggggcggggagccccgtagaacc
gagggggtcggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgac
gtgggcccgcgctacacgcagttgcagtacatcggcgagggcgcgtacggcatggtcagc
tcggcctatgaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgag
catcagacctactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccat
gagaatgtcatcggcatccgagacattctgcgggcgtccaccctggaagccatgagggat
gtctacattgtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcag
ctgagcaatgaccatatctgctacttcctctaccagatcctgcggggcctcaaatacatc
cactccgccaacgtgctccaccgagatctaaagccctccaacctgctcatcaacaccacc
tgcgaccttaagatttgcgatttcggcctggcccggattgccgatcctgagcatgaccac
accggcttcctgacggagtatgtggctacgcgctggtaccgggccccagagatcatgctg
aactccaagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgag
atgctctctaaccggcccatcttccccggcaagcactacctggatcagctcaaccacatt
ctgggcatcctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcc
cgaaactacctacagtctctgccctccaagaccaaggtggcttgggccaagcttttcccc
aagtcagactccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaa
cggatcacagtggaggaagcgctggctcacccctacctggagcagtactatgacccgacg
gatgagccagtggccgaggagcccttcaccttcgccatggagctggacgacctacctaag
gagcggctgaaggagctcatcttccaggagacagcacgcttccagcccggagtgctggag
gccccctag

DBGET integrated database retrieval system