Pongo pygmaeus (Bornean orangutan): 129016279 Help Entry 129016279         CDS       T10128                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04066   HIF-1 signaling pathway ppyg04120   Ubiquitin mediated proteolysis ppyg05170   Human immunodeficiency virus 1 infection ppyg05200   Pathways in cancer ppyg05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:ppyg00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     129016279 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     129016279 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129016279 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     129016279 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129016279 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ppyg04121]     129016279 (ELOB)    03400 DNA repair and recombination proteins [BR:ppyg03400]     129016279 (ELOB) Ubiquitin system [BR:ppyg04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      129016279 (ELOB)    Cul5 complex      129016279 (ELOB) DNA repair and recombination proteins [BR:ppyg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      129016279 (ELOB) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  129016279 NCBI-ProteinID:  XP_054311506 LinkDB All DBs Position 18:3001994..3007415 Genome browser AA seq 163 aa AA seqDB search MAAAAGRGCAGGGGAARGMLGHARAAGNGAERGCAGASRGEAAAAMDVFLMIRRHKTTIF TDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATV GLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atggcggcggctgcggggcggggctgcgctgggggaggcggggcggcgcggggcatgctg ggccacgcgcgggctgccgggaacggggcggagcgcggctgcgccggcgcgtcgagggga gaggcagccgccgcgatggacgtgttcctcatgatccggcgccacaagaccaccatcttc acggacgccaaggagtctagcacggtgttcgaactgaagcgcatcgtcgagggcatcctc aagcggcctcctgacgagcagcggctgtacaaggatgaccaactcttggatgatggcaag acactgggcgagtgtggcttcaccagtcaaacagcacggccacaggccccagccacagtg gggctggccttccgggcagatgacacctttgaggccctgtgcatcgagccgttttccagc ccacccgagctgcccgatgtgatgaagccccaggactcgggaagcagtgccaatgaacaa gccgtgcagtga

DBGET integrated database retrieval system