Pongo pygmaeus (Bornean orangutan): 129017175 Help Entry 129017175         CDS       T10128                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04061   Viral protein interaction with cytokine and cytokine receptor ppyg04062   Chemokine signaling pathway ppyg04620   Toll-like receptor signaling pathway ppyg04621   NOD-like receptor signaling pathway ppyg04623   Cytosolic DNA-sensing pathway ppyg04668   TNF signaling pathway ppyg05020   Prion disease ppyg05142   Chagas disease ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05168   Herpes simplex virus 1 infection ppyg05323   Rheumatoid arthritis ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     129017175 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129017175 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     129017175 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129017175 (CCL5)    04621 NOD-like receptor signaling pathway     129017175 (CCL5)    04623 Cytosolic DNA-sensing pathway     129017175 (CCL5)    04062 Chemokine signaling pathway     129017175 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     129017175 (CCL5)    05168 Herpes simplex virus 1 infection     129017175 (CCL5)    05163 Human cytomegalovirus infection     129017175 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     129017175 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     129017175 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     129017175 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129017175 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129017175 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:ppyg00536]     129017175 (CCL5) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Chemokines    129017175 (CCL5) Glycosaminoglycan binding proteins [BR:ppyg00536]  Heparan sulfate / Heparin   Chemokines    129017175 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  129017175 NCBI-ProteinID:  XP_054313376 LinkDB All DBs Position 19:complement(51831081..51839641) Genome browser AA seq 91 aa AA seqDB search MKVSAAALAVILIATALCAPASASPYASDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP AVVFVTRKNRQVCANPEKKWVREYINSLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccgcggcggccctcgctgtcatcctcattgctaccgccctctgcgctcct gcatctgcctccccatatgcctcggataccacaccctgctgctttgcctacattgcccgc ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg gttcgggagtacatcaactctttggagatgagctag

DBGET integrated database retrieval system