Pongo pygmaeus (Bornean orangutan): 129017180 Help Entry 129017180         CDS       T10128                                  Symbol CENPX Name (RefSeq) centromere protein X isoform X2   KO K15360   centromere protein X Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ppyg00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129017180 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ppyg03400]     129017180 (CENPX) DNA repair and recombination proteins [BR:ppyg03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129017180 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  129017180 NCBI-ProteinID:  XP_054313384 LinkDB All DBs Position 19:complement(100282598..100286799) Genome browser AA seq 81 aa AA seqDB search MEGPGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAE DALRVDVDQLEKVLPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggagggacccggagctggatccggcttccggaaggagctggtgagcaggctgctgcac ctgcacttcaaggatgacaagaccaaagtgagcggggatgcgctgcagctcatggtggag ttgctgaaggtcttcgttgtggaagcagcagtccgcggggtgcggcaggcccaggcagaa gacgcgctccgtgtggacgtggaccagctggagaaggtgcttccgcagctgctcctggac ttctag

DBGET integrated database retrieval system