Pongo pygmaeus (Bornean orangutan): 129020854 Help Entry 129020854         CDS       T10128                                  Name (RefSeq) histone H2B type 2-F isoform X2   KO K11252   histone H2B Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04613   Neutrophil extracellular trap formation ppyg05034   Alcoholism ppyg05203   Viral carcinogenesis ppyg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppyg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129020854  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     129020854   09163 Immune disease    05322 Systemic lupus erythematosus     129020854   09165 Substance dependence    05034 Alcoholism     129020854  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129020854   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129020854 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129020854 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129020854 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Motif Other DBs NCBI-GeneID:  129020854 NCBI-ProteinID:  XP_054321713 LinkDB All DBs Position 1:100652611..100709980 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKVQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccggatccagcaaaatccgctcctgctcccaagaagggctccaaaaaggctgttacg aaagtgcagaagaaggacggcaagaaacgcaagcgcagccgcaaggagagctactccgtt tacgtgtacaaggtgctgaagcaggtccaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgctggagaggcgtcccgc ctggcacactacaacaagcgctccaccatcacatcccgcgagatccagacggccgtgcgc ctgctgctgcccggtgagctggccaagcacgccgtgtccgagggcaccaaggcggtcact aagtataccagctcgaagtag

DBGET integrated database retrieval system