Pongo pygmaeus (Bornean orangutan): 129021472 Help Entry 129021472         CDS       T10128                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg01521   EGFR tyrosine kinase inhibitor resistance ppyg01524   Platinum drug resistance ppyg04014   Ras signaling pathway ppyg04064   NF-kappa B signaling pathway ppyg04115   p53 signaling pathway ppyg04137   Mitophagy - animal ppyg04140   Autophagy - animal ppyg04151   PI3K-Akt signaling pathway ppyg04210   Apoptosis ppyg04215   Apoptosis - multiple species ppyg04621   NOD-like receptor signaling pathway ppyg04630   JAK-STAT signaling pathway ppyg05012   Parkinson disease ppyg05014   Amyotrophic lateral sclerosis ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05145   Toxoplasmosis ppyg05162   Measles ppyg05166   Human T-cell leukemia virus 1 infection ppyg05168   Herpes simplex virus 1 infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05200   Pathways in cancer ppyg05202   Transcriptional misregulation in cancer ppyg05212   Pancreatic cancer ppyg05220   Chronic myeloid leukemia ppyg05222   Small cell lung cancer ppyg05225   Hepatocellular carcinoma ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129021472 (BCL2L1)    04630 JAK-STAT signaling pathway     129021472 (BCL2L1)    04064 NF-kappa B signaling pathway     129021472 (BCL2L1)    04151 PI3K-Akt signaling pathway     129021472 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     129021472 (BCL2L1)    04137 Mitophagy - animal     129021472 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     129021472 (BCL2L1)    04215 Apoptosis - multiple species     129021472 (BCL2L1)    04115 p53 signaling pathway     129021472 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     129021472 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129021472 (BCL2L1)    05202 Transcriptional misregulation in cancer     129021472 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     129021472 (BCL2L1)    05225 Hepatocellular carcinoma     129021472 (BCL2L1)    05220 Chronic myeloid leukemia     129021472 (BCL2L1)    05222 Small cell lung cancer     129021472 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129021472 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     129021472 (BCL2L1)    05162 Measles     129021472 (BCL2L1)    05168 Herpes simplex virus 1 infection     129021472 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     129021472 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     129021472 (BCL2L1)    05014 Amyotrophic lateral sclerosis     129021472 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     129021472 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129021472 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     129021472 (BCL2L1)    01524 Platinum drug resistance     129021472 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppyg01009]     129021472 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129021472 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ppyg02000]     129021472 (BCL2L1) Protein phosphatases and associated proteins [BR:ppyg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      129021472 (BCL2L1) Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     129021472 (BCL2L1) Transporters [BR:ppyg02000]  Other transporters   Pores ion channels [TC:1]    129021472 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  129021472 NCBI-ProteinID:  XP_054322856 LinkDB All DBs Position 21:complement(34077812..34137710) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcattcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggattgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggatacttttgtggaactctatgggaacaatgcagca gctgagagccgaaagggccaggaacgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system