Pongo pygmaeus (Bornean orangutan): 129021564 Help Entry 129021564         CDS       T10128                                  Symbol NXT1 Name (RefSeq) NTF2-related export protein 1   KO K14285   NTF2-related export protein 1/2 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg03008   Ribosome biogenesis in eukaryotes ppyg03013   Nucleocytoplasmic transport ppyg03015   mRNA surveillance pathway ppyg05014   Amyotrophic lateral sclerosis ppyg05164   Influenza A Brite KEGG Orthology (KO) [BR:ppyg00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     129021564 (NXT1)    03015 mRNA surveillance pathway     129021564 (NXT1)    03008 Ribosome biogenesis in eukaryotes     129021564 (NXT1)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     129021564 (NXT1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129021564 (NXT1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ppyg03019]     129021564 (NXT1)    03009 Ribosome biogenesis [BR:ppyg03009]     129021564 (NXT1) Messenger RNA biogenesis [BR:ppyg03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Nuclear pore complex      129021564 (NXT1) Ribosome biogenesis [BR:ppyg03009]  Eukaryotic type   Pre-60S particles    Export and cytoplasmic maturation factors     129021564 (NXT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NTF2 NXF_NTF2 Cofilin_ADF Glyco_tran_10_N Motif Other DBs NCBI-GeneID:  129021564 NCBI-ProteinID:  XP_054323113 LinkDB All DBs Position 21:18126186..18137736 Genome browser AA seq 140 aa AA seqDB search MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESLSE FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQAS PSNTVWKIASDCFRFQDWAS NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcatctgtggatttcaagacctatgtggatcaggcctgcagagctgctgaggagttt gtcaatgtctactacaccaccatggataagcggcggcgtttgctgtcccgcctgtacatg ggcacagctaccctggtctggaatggcaatgctgtttcaggacaagaatccttgagtgag ttttttgaaatgttgccttccagcgagttccaaatcagcgtggtagactgccagcctgtt catgatgaagccacaccgagccagaccacggtccttgttgtgatctgtggatcagtgaag tttgaggggaacaaacaacgggacttcaaccagaacttcatcctgaccgcccaggcctcg cccagcaacacagtgtggaaaatcgcaagtgactgcttccgcttccaggactgggccagc tag

DBGET integrated database retrieval system