Pongo pygmaeus (Bornean orangutan): 129024409 Help Entry 129024409         CDS       T10128                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04613   Neutrophil extracellular trap formation ppyg05034   Alcoholism ppyg05202   Transcriptional misregulation in cancer ppyg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppyg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129024409  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129024409   09163 Immune disease    05322 Systemic lupus erythematosus     129024409   09165 Substance dependence    05034 Alcoholism     129024409  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129024409   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129024409 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129024409 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129024409 SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  129024409 NCBI-ProteinID:  XP_054327431 LinkDB All DBs Position X:<127794670..127795132 Genome browser AA seq 139 aa AA seqDB search LCTVARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQK STELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKR VTIMPKDIQLACRIRGERA NT seq 420 nt NT seq  +upstreamnt  +downstreamnt ctctgtaccgtggctcgtacaaagcagaccgcccgcaaatcgaccggtggtaaagcaccc aggaagcaactggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaag aaacctcatcgttacaggcctggtactgtggcgctccgtgaaattagacgttatcagaag tccactgaacttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcag gactttaaaacagatctgcgcttccagagcgcagctatcggtgctttgcaggaggcaagt gaggcctatctggtcggcctttttgaagacaccaacctgtgtgctatccatgccaaacgt gtaacaattatgccaaaagacatccagctagcatgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system