Pongo pygmaeus (Bornean orangutan): 129024787 Help Entry 129024787         CDS       T10128                                  Name (RefSeq) histone H2A-Bbd type 2/3   KO K11251   histone H2A Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg03082   ATP-dependent chromatin remodeling ppyg04217   Necroptosis ppyg04613   Neutrophil extracellular trap formation ppyg05034   Alcoholism ppyg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppyg00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     129024787  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129024787  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129024787  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     129024787   09165 Substance dependence    05034 Alcoholism     129024787  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129024787   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129024787 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129024787 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129024787 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  129024787 NCBI-ProteinID:  XP_054327966 LinkDB All DBs Position X:159779181..159779837 Genome browser AA seq 153 aa AA seqDB search MRGWALVARIHSTGRGNCHLESWPSSLGRAEIAHSTPSMPRRRSHRGSSGAGGRGRTCSR TVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNNGERN ITPLLLDMVVHNNRLLSTLFDTTTISQVAPGGD NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgaggggctgggccctggtcgctaggatacacagtactggacgcggtaactgtcatctt gagagttggccaagctctctaggccgagccgagatagcacactcaacgcccagcatgccg aggaggaggagccatcgagggtcctccggtgctggtggccgggggcggacctgctctcgc accgtccgagcggagctttcgttttcggtgagccaggtggagcgcagtctacgggagggc cactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttattgagtac ctgacggccaaggtcctggagctggcgggcaacgaggcccagaacaacggagagaggaac atcactcccctgctgctggacatggtggttcacaacaacaggctgctgagcacccttttc gacacaaccaccatctctcaagtggcccccggcggggactag

DBGET integrated database retrieval system