Pongo pygmaeus (Bornean orangutan): 129028587 Help Entry 129028587         CDS       T10128                                  Name (RefSeq) profilin-1-like   KO K05759   profilin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04015   Rap1 signaling pathway ppyg04810   Regulation of actin cytoskeleton ppyg05014   Amyotrophic lateral sclerosis ppyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129028587  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129028587  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129028587   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129028587  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129028587   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppyg04812]     129028587    04147 Exosome [BR:ppyg04147]     129028587 Membrane trafficking [BR:ppyg04131]  Others   Actin-binding proteins    Others     129028587 Cytoskeleton proteins [BR:ppyg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129028587 Exosome [BR:ppyg04147]  Exosomal proteins   Proteins found in most exosomes    129028587 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129028587 NCBI-ProteinID:  XP_054330258 LinkDB All DBs Position 1:complement(100927196..100927519) Genome browser AA seq 107 aa AA seqDB search MTIMGNKDLPSNWAAVSGKTFINITPAEVGVLVGKDWSSFFMNGLTLGGQKYTVVPDSLL QDGELTVDLHMKSVSGARTFNVTVTMTAKTLGLLMGKEGVHGSFTIS NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgaccatcatgggcaacaaggacttgccctccaactgggctgccgtctcagggaaaacc ttcatcaacatcaccccagctgaggttggtgtcctggttggcaaagactggtcaagcttt ttcatgaatgggctgacactggggggccagaaatatactgtggtcccggactcactgctg caggatggggaattgaccgtggatcttcatatgaagagcgtcagtggagcccgcaccttc aatgtcactgtcaccatgactgccaagacgctaggcctgctaatgggcaaagaaggagtc cacggtagtttcaccatttcataa

DBGET integrated database retrieval system