Pongo pygmaeus (Bornean orangutan): 129030832 Help Entry 129030832         CDS       T10128                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04015   Rap1 signaling pathway ppyg04810   Regulation of actin cytoskeleton ppyg05014   Amyotrophic lateral sclerosis ppyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129030832 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129030832 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129030832 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129030832 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129030832 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppyg04812]     129030832 (PFN4)    04147 Exosome [BR:ppyg04147]     129030832 (PFN4) Membrane trafficking [BR:ppyg04131]  Others   Actin-binding proteins    Others     129030832 (PFN4) Cytoskeleton proteins [BR:ppyg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129030832 (PFN4) Exosome [BR:ppyg04147]  Exosomal proteins   Proteins found in most exosomes    129030832 (PFN4) SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129030832 NCBI-ProteinID:  XP_054332548 LinkDB All DBs Position 12:109829688..109838728 Genome browser AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVQTLVNGFAKNPLQAR RGGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta atgcccagtgatgtccaaacactggtgaatggatttgccaagaaccctttgcaagcccga agaggaggattgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct ctttatgccaaaaatgagaacactggtgtagttgtcgtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttaa

DBGET integrated database retrieval system