Pongo pygmaeus (Bornean orangutan): 129032651 Help Entry 129032651         CDS       T10128                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04015   Rap1 signaling pathway ppyg04810   Regulation of actin cytoskeleton ppyg05014   Amyotrophic lateral sclerosis ppyg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     129032651 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     129032651 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129032651 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129032651 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129032651 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ppyg04812]     129032651 (PFN2)    04147 Exosome [BR:ppyg04147]     129032651 (PFN2) Membrane trafficking [BR:ppyg04131]  Others   Actin-binding proteins    Others     129032651 (PFN2) Cytoskeleton proteins [BR:ppyg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      129032651 (PFN2) Exosome [BR:ppyg04147]  Exosomal proteins   Proteins found in most exosomes    129032651 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  129032651 NCBI-ProteinID:  XP_054336226 LinkDB All DBs Position 2:complement(158789058..158795136) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system