Pongo pygmaeus (Bornean orangutan): 129033206 Help Entry 129033206         CDS       T10128                                  Symbol GHRL Name (RefSeq) appetite-regulating hormone   KO K05254   ghrelin Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04024   cAMP signaling pathway ppyg04080   Neuroactive ligand-receptor interaction ppyg04081   Hormone signaling ppyg04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     129033206 (GHRL)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     129033206 (GHRL)    04081 Hormone signaling     129033206 (GHRL)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     129033206 (GHRL)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129033206 (GHRL) Cytokines and neuropeptides [BR:ppyg04052]  Neuropeptides   GPCR binding    129033206 (GHRL) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Motilin_assoc Motilin_ghrelin Motif Other DBs NCBI-GeneID:  129033206 NCBI-ProteinID:  XP_054337334 LinkDB All DBs Position 2:67607936..67616073 Genome browser AA seq 117 aa AA seqDB search MPSPGTICSLLLLGMLWLNLAMAGSSFLSPEHQRVQQRKESKKPLAKLQPRALEGWLRPE DGGQAEGAEDELEIRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgccctccccaggtaccatctgcagcctcctgctcctcggcatgctctggctgaacttg gccatggcaggctccagcttcctgagccctgaacaccagagagtccagcagagaaaggag tccaagaagccactagccaagctgcagccccgagctctagaaggctggctccgcccggaa gatggaggtcaggcagaaggggcagaggatgaactggaaatccggttcaacgcccccttt gatgttggaatcaagctgtcaggggttcagtaccagcagcacagccaggccctggggaag tttcttcaggacatcctctgggaagaggccaaagaggccccagctgacaagtga

DBGET integrated database retrieval system