Pongo pygmaeus (Bornean orangutan): 129033507 Help Entry 129033507         CDS       T10128                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04137   Mitophagy - animal ppyg04140   Autophagy - animal ppyg04142   Lysosome biogenesis ppyg04144   Endocytosis ppyg04145   Phagosome ppyg04148   Efferocytosis ppyg05132   Salmonella infection ppyg05146   Amoebiasis ppyg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129033507 (RAB7A)    04145 Phagosome     129033507 (RAB7A)    04142 Lysosome biogenesis     129033507 (RAB7A)    04140 Autophagy - animal     129033507 (RAB7A)    04137 Mitophagy - animal     129033507 (RAB7A)    04148 Efferocytosis     129033507 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129033507 (RAB7A)    05152 Tuberculosis     129033507 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     129033507 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129033507 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129033507 (RAB7A)    04031 GTP-binding proteins [BR:ppyg04031]     129033507 (RAB7A) Membrane trafficking [BR:ppyg04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     129033507 (RAB7A) Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129033507 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    129033507 (RAB7A)   Exosomal proteins of colorectal cancer cells    129033507 (RAB7A)   Exosomal proteins of bladder cancer cells    129033507 (RAB7A) GTP-binding proteins [BR:ppyg04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     129033507 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 G-alpha AAA_5 AAA_24 ATPase_2 NB-ARC AAA_14 NACHT SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  129033507 NCBI-ProteinID:  XP_054338136 LinkDB All DBs Position 2:61458936..61547072 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca ataggagctgactttctgacaaaggaggtgatggtggatgacaggctagtcacaatgcag atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttccccttt gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system