Pongo pygmaeus (Bornean orangutan): 129037390 Help Entry 129037390         CDS       T10128                                  Symbol IL3 Name (RefSeq) interleukin-3   KO K04736   interleukin 3 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04151   PI3K-Akt signaling pathway ppyg04210   Apoptosis ppyg04630   JAK-STAT signaling pathway ppyg04640   Hematopoietic cell lineage ppyg04664   Fc epsilon RI signaling pathway ppyg05200   Pathways in cancer ppyg05202   Transcriptional misregulation in cancer ppyg05221   Acute myeloid leukemia ppyg05310   Asthma Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129037390 (IL3)    04151 PI3K-Akt signaling pathway     129037390 (IL3)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129037390 (IL3)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     129037390 (IL3)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129037390 (IL3)    04664 Fc epsilon RI signaling pathway     129037390 (IL3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129037390 (IL3)    05202 Transcriptional misregulation in cancer     129037390 (IL3)   09162 Cancer: specific types    05221 Acute myeloid leukemia     129037390 (IL3)   09163 Immune disease    05310 Asthma     129037390 (IL3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129037390 (IL3)    00536 Glycosaminoglycan binding proteins [BR:ppyg00536]     129037390 (IL3) Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interleukins    129037390 (IL3) Glycosaminoglycan binding proteins [BR:ppyg00536]  Heparan sulfate / Heparin   Cytokines    129037390 (IL3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL3 Ldl_recept_b Rib_mS39_PPR CdiA_C_tRNase Motif Other DBs NCBI-GeneID:  129037390 NCBI-ProteinID:  XP_054345439 LinkDB All DBs Position 4:136576257..136578800 Genome browser AA seq 152 aa AA seqDB search MSCLPVLLLLQLLVSPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN GEDQDILMENNLRRPNLEAFNKAVKSLQNASAIESILKNLPPCLPMATAAPMRHPIRIKD GDWNEFRRKLTFYLKTLENAQAQQMTLSVEIS NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgagctgcctgcccgtcctgctcctgctccaactcctggtcagccccggactccaagct cccatgacccagacaacttccttgaagacaagctgggttaactgctctaacatgattgac gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat ggggaagaccaagacattctgatggaaaataacctccgaaggccaaatctggaggcattc aacaaggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc ccgccatgcctgcccatggccacggccgcacccatgcgacatccaatccgtatcaaggac ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgca caggctcaacagatgactttgagcgtcgagatctcttga

DBGET integrated database retrieval system