Pongo pygmaeus (Bornean orangutan): 129038404 Help Entry 129038404         CDS       T10128                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04613   Neutrophil extracellular trap formation ppyg05034   Alcoholism ppyg05202   Transcriptional misregulation in cancer ppyg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppyg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129038404  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     129038404   09163 Immune disease    05322 Systemic lupus erythematosus     129038404   09165 Substance dependence    05034 Alcoholism     129038404  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129038404   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129038404 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129038404 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129038404 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  129038404 NCBI-ProteinID:  XP_054347337 LinkDB All DBs Position 5:26132745..26133424 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag ctggccactaaggcagcccgcaagagcgctccggccactggcggcgtgaaaaagcctcac cgctaccggcccggcactgtggctctgcgcgagatccgccgttatcagaagtccactgaa ctgctcattcgtaaactacctttccagcgcctggtgcgcgagattgcgcaggactttaaa acagacctgcgtttccagagctccgctgtgatggctctgcaggaagcgtgcgaggcctac ttggtggggctgtttgaggacaccaacctgtgtgccatccacgccaagcgcgtcactatc atgcccaaggacatccagctcgcccgccgcatccgcggagagcgggcgtga

DBGET integrated database retrieval system