Pongo pygmaeus (Bornean orangutan): 129038464 Help Entry 129038464         CDS       T10128                                  Name (RefSeq) histone H2B type 1-H   KO K11252   histone H2B Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04613   Neutrophil extracellular trap formation ppyg05034   Alcoholism ppyg05203   Viral carcinogenesis ppyg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppyg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129038464  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     129038464   09163 Immune disease    05322 Systemic lupus erythematosus     129038464   09165 Substance dependence    05034 Alcoholism     129038464  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppyg03036]     129038464   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129038464 Chromosome and associated proteins [BR:ppyg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129038464 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129038464 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  129038464 NCBI-ProteinID:  XP_054347486 LinkDB All DBs Position 5:26366572..26367229 Genome browser AA seq 126 aa AA seqDB search MPDPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgatccagctaagtccgctcccgccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggatggcaagaagcgtaaacgcagccgcaaggagagctactccgtg tacgtttacaaggtgctgaagcaggtccaccccgacaccggcatctcctccaaagccatg gggatcatgaattcctttgtcaacgatatctttgagcgcatcgccggcgaggcttcccgc ctggctcattacaacaagcgttcgaccatcacctccagggagatccagacggccgtgcgc ctgctgctgcctggggaactggccaagcacgccgtgtccgagggcactaaggccgtcacc aagtacaccagttccaagtaa

DBGET integrated database retrieval system