Pongo pygmaeus (Bornean orangutan): 129040898 Help Entry 129040898         CDS       T10128                                  Name (RefSeq) ras-related protein Rab-5A-like   KO K07887   Ras-related protein Rab-5A Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04014   Ras signaling pathway ppyg04137   Mitophagy - animal ppyg04144   Endocytosis ppyg04145   Phagosome ppyg04148   Efferocytosis ppyg04962   Vasopressin-regulated water reabsorption ppyg05014   Amyotrophic lateral sclerosis ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05132   Salmonella infection ppyg05146   Amoebiasis ppyg05152   Tuberculosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129040898  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129040898    04145 Phagosome     129040898    04137 Mitophagy - animal     129040898    04148 Efferocytosis     129040898  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     129040898  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129040898    05152 Tuberculosis     129040898   09174 Infectious disease: parasitic    05146 Amoebiasis     129040898   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     129040898    05022 Pathways of neurodegeneration - multiple diseases     129040898  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ppyg04131]     129040898   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppyg04147]     129040898    04031 GTP-binding proteins [BR:ppyg04031]     129040898 Membrane trafficking [BR:ppyg04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     129040898  Endosome - Lysosome transport     129040898 Exosome [BR:ppyg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129040898   Exosomal proteins of other body fluids (saliva and urine)    129040898   Exosomal proteins of colorectal cancer cells    129040898   Exosomal proteins of bladder cancer cells    129040898 GTP-binding proteins [BR:ppyg04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     129040898 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU MMR_HSR1 RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  129040898 NCBI-ProteinID:  XP_054351757 LinkDB All DBs Position 6:130436949..130437651 Genome browser AA seq 199 aa AA seqDB search MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCFDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMKTSAKTSVNVNEIFMAIAKK LPKNEPQNPEANSARGRVE NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggctagtcgaggcgcaacaagacccaatgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtccgctgttggcaaatcaagcctagtgcttcgtttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcttttctaacccaa actgtatgttttgatgacactacagtaaagtttgaaatatgggatacagctggtcaagaa cgataccatagcctagcaccaatgtactacagaggagcacaagcagccatagttgtatat gatatcacaaatgaggagtcctttgcaagagcaaaaaattgggttaaagaacttcagagg caagcaagtcctaacattgtaatagctttatcaggaaacaaggctgacctagcaaataaa agagcagtagatttccaggaagcacagtcctatgcagatgacaatagtttattattcatg aagacatccgctaaaacatcagtgaatgtaaatgaaatattcatggcaatagctaaaaaa ctgccaaagaatgaaccacaaaatccagaagcaaattctgccagaggaagagtcgagtag

DBGET integrated database retrieval system