Pongo pygmaeus (Bornean orangutan): 129044032 Help Entry 129044032         CDS       T10128                                  Name (RefSeq) interferon alpha-14   KO K05414   interferon alpha Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04060   Cytokine-cytokine receptor interaction ppyg04151   PI3K-Akt signaling pathway ppyg04217   Necroptosis ppyg04620   Toll-like receptor signaling pathway ppyg04621   NOD-like receptor signaling pathway ppyg04622   RIG-I-like receptor signaling pathway ppyg04623   Cytosolic DNA-sensing pathway ppyg04630   JAK-STAT signaling pathway ppyg04650   Natural killer cell mediated cytotoxicity ppyg04936   Alcoholic liver disease ppyg05152   Tuberculosis ppyg05160   Hepatitis C ppyg05161   Hepatitis B ppyg05162   Measles ppyg05163   Human cytomegalovirus infection ppyg05164   Influenza A ppyg05165   Human papillomavirus infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05168   Herpes simplex virus 1 infection ppyg05169   Epstein-Barr virus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05171   Coronavirus disease - COVID-19 ppyg05200   Pathways in cancer ppyg05320   Autoimmune thyroid disease ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     129044032    04151 PI3K-Akt signaling pathway     129044032   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129044032  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129044032  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     129044032    04621 NOD-like receptor signaling pathway     129044032    04622 RIG-I-like receptor signaling pathway     129044032    04623 Cytosolic DNA-sensing pathway     129044032    04650 Natural killer cell mediated cytotoxicity     129044032  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129044032   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129044032    05161 Hepatitis B     129044032    05160 Hepatitis C     129044032    05171 Coronavirus disease - COVID-19     129044032    05164 Influenza A     129044032    05162 Measles     129044032    05168 Herpes simplex virus 1 infection     129044032    05163 Human cytomegalovirus infection     129044032    05167 Kaposi sarcoma-associated herpesvirus infection     129044032    05169 Epstein-Barr virus infection     129044032    05165 Human papillomavirus infection     129044032   09171 Infectious disease: bacterial    05152 Tuberculosis     129044032   09163 Immune disease    05320 Autoimmune thyroid disease     129044032   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129044032   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     129044032  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ppyg04052]     129044032 Cytokines and neuropeptides [BR:ppyg04052]  Cytokines   Interferons    129044032 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N Motif Other DBs NCBI-GeneID:  129044032 NCBI-ProteinID:  XP_054357520 LinkDB All DBs Position 13:36190165..36191168 Genome browser AA seq 189 aa AA seqDB search MALPFALMMALVVLSCKSSGSLGCNLSQTHSLNSRRTLMLMAQMRRISPFSCLKDRHDFE FPQEEFDGNQFQKAQAISVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYIELFQQMNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN LQKKLRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggcattgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagtggc tctctgggctgtaacctgtctcaaacccacagcctgaatagcaggaggactttgatgctc atggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa tttccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc catgagatgatccagcagatcttcaacctcttcagcacaaaggactcatctgctgcttgg gatgagaccctcctagacaaattctacattgaacttttccagcaaatgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactctttatctgatggagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcgacaaac ttgcaaaaaaaattaaggaggaaggattga

DBGET integrated database retrieval system