Pongo pygmaeus (Bornean orangutan): 129044302 Help Entry 129044302         CDS       T10128                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg04010   MAPK signaling pathway ppyg04020   Calcium signaling pathway ppyg04022   cGMP-PKG signaling pathway ppyg04114   Oocyte meiosis ppyg04218   Cellular senescence ppyg04310   Wnt signaling pathway ppyg04360   Axon guidance ppyg04370   VEGF signaling pathway ppyg04380   Osteoclast differentiation ppyg04625   C-type lectin receptor signaling pathway ppyg04650   Natural killer cell mediated cytotoxicity ppyg04658   Th1 and Th2 cell differentiation ppyg04659   Th17 cell differentiation ppyg04660   T cell receptor signaling pathway ppyg04662   B cell receptor signaling pathway ppyg04720   Long-term potentiation ppyg04724   Glutamatergic synapse ppyg04921   Oxytocin signaling pathway ppyg04922   Glucagon signaling pathway ppyg04924   Renin secretion ppyg05010   Alzheimer disease ppyg05014   Amyotrophic lateral sclerosis ppyg05020   Prion disease ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05031   Amphetamine addiction ppyg05152   Tuberculosis ppyg05163   Human cytomegalovirus infection ppyg05166   Human T-cell leukemia virus 1 infection ppyg05167   Kaposi sarcoma-associated herpesvirus infection ppyg05170   Human immunodeficiency virus 1 infection ppyg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ppyg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ppyg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129044302 (PPP3R2)    04310 Wnt signaling pathway     129044302 (PPP3R2)    04370 VEGF signaling pathway     129044302 (PPP3R2)    04020 Calcium signaling pathway     129044302 (PPP3R2)    04022 cGMP-PKG signaling pathway     129044302 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129044302 (PPP3R2)    04218 Cellular senescence     129044302 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129044302 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     129044302 (PPP3R2)    04660 T cell receptor signaling pathway     129044302 (PPP3R2)    04658 Th1 and Th2 cell differentiation     129044302 (PPP3R2)    04659 Th17 cell differentiation     129044302 (PPP3R2)    04662 B cell receptor signaling pathway     129044302 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     129044302 (PPP3R2)    04921 Oxytocin signaling pathway     129044302 (PPP3R2)    04924 Renin secretion     129044302 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     129044302 (PPP3R2)    04720 Long-term potentiation     129044302 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     129044302 (PPP3R2)    04380 Osteoclast differentiation     129044302 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     129044302 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     129044302 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     129044302 (PPP3R2)    05163 Human cytomegalovirus infection     129044302 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     129044302 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     129044302 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     129044302 (PPP3R2)    05014 Amyotrophic lateral sclerosis     129044302 (PPP3R2)    05020 Prion disease     129044302 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     129044302 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     129044302 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129044302 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ppyg01009]     129044302 (PPP3R2) Protein phosphatases and associated proteins [BR:ppyg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129044302 (PPP3R2) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EF-hand_FSTL1 EF_SSP120 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  129044302 NCBI-ProteinID:  XP_054358114 LinkDB All DBs Position 13:complement(91986194..91987191) Genome browser AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCSHFDNDEIKRLGRRFKKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTDGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLTDWQLQQLVDKTIIILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgctcccactttgacaat gatgaaattaaaaggctgggcaggaggtttaagaagttggacttggacaaatcagggtct ctgagcgtggaggagttcatgtccctgccggaactgcgccacaacccgttggtgcggaga gtgatcgacgtcttcgacaccgacggtgatggagaagtggacttcaaggaattcatcctg gggacctcccagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgttcagc atttacgacatggataaagatggctatatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctaacggactggcagctccagcagctggtcgacaaaaccatc atcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system