Pongo pygmaeus (Bornean orangutan): 807902 Help Entry 807902            CDS       T10128                                  Symbol ND3 Name (RefSeq) NADH dehydrogenase subunit 3   KO K03880   NADH-ubiquinone oxidoreductase chain 3 [EC:7.1.1.2] Organism ppyg  Pongo pygmaeus (Bornean orangutan) Pathway ppyg00190   Oxidative phosphorylation ppyg01100   Metabolic pathways ppyg04714   Thermogenesis ppyg04723   Retrograde endocannabinoid signaling ppyg05010   Alzheimer disease ppyg05012   Parkinson disease ppyg05014   Amyotrophic lateral sclerosis ppyg05016   Huntington disease ppyg05020   Prion disease ppyg05022   Pathways of neurodegeneration - multiple diseases ppyg05208   Chemical carcinogenesis - reactive oxygen species ppyg05415   Diabetic cardiomyopathy Module ppyg_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:ppyg00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     807902 (ND3)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     807902 (ND3)   09159 Environmental adaptation    04714 Thermogenesis     807902 (ND3)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     807902 (ND3)   09164 Neurodegenerative disease    05010 Alzheimer disease     807902 (ND3)    05012 Parkinson disease     807902 (ND3)    05014 Amyotrophic lateral sclerosis     807902 (ND3)    05016 Huntington disease     807902 (ND3)    05020 Prion disease     807902 (ND3)    05022 Pathways of neurodegeneration - multiple diseases     807902 (ND3)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     807902 (ND3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ppyg03029]     807902 (ND3) Enzymes [BR:ppyg01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      807902 (ND3) Mitochondrial biogenesis [BR:ppyg03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     807902 (ND3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q4 Motif Other DBs NCBI-GeneID:  807902 NCBI-ProteinID:  NP_008232 UniProt:  Q9T9X5 G0Z9T7 LinkDB All DBs Position MT:9504..9849 Genome browser AA seq 115 aa AA seqDB search MNFVLALTINTLLALLLMILTFWLPQLNPYMEKSDPYECGFDPAYPARIPFSMKFFLVAI TFLLFDLEIALLLPLPWALQTTNLPLMTTSSLMLIIILALGLTYEWSQKGLDWTE NT seq 346 nt NT seq  +upstreamnt  +downstreamnt attaacttcgtcctagctctgacaattaacaccctccttgccctactactaataatcctc acattctgactaccccaacttaacccctacatagaaaaatccgacccatacgaatgtgga tttgaccccgcataccctgcccgcattcctttctccataaaattcttcctagtagccatc accttcctactattcgatctagaaattgccctactactacccctaccatgagccctacaa acaaccaacttaccactaataaccacatcatcgcttatattaattattatcctggccctg ggcctaacttacgaatgatcccaaaaaggattagactgaaccgaat

DBGET integrated database retrieval system