Photinus pyralis (common eastern firefly): 116178437
Help
Entry
116178437 CDS
T07438
Name
(RefSeq) S-phase kinase-associated protein 1
KO
K03094
S-phase kinase-associated protein 1
Organism
ppyr
Photinus pyralis (common eastern firefly)
Pathway
ppyr03083
Polycomb repressive complex
ppyr04120
Ubiquitin mediated proteolysis
ppyr04141
Protein processing in endoplasmic reticulum
ppyr04310
Wnt signaling pathway
ppyr04341
Hedgehog signaling pathway - fly
ppyr04350
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:
ppyr00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
116178437
04120 Ubiquitin mediated proteolysis
116178437
09126 Chromosome
03083 Polycomb repressive complex
116178437
09130 Environmental Information Processing
09132 Signal transduction
04310 Wnt signaling pathway
116178437
04341 Hedgehog signaling pathway - fly
116178437
04350 TGF-beta signaling pathway
116178437
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ppyr04131
]
116178437
04121 Ubiquitin system [BR:
ppyr04121
]
116178437
03036 Chromosome and associated proteins [BR:
ppyr03036
]
116178437
Membrane trafficking [BR:
ppyr04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
116178437
Ubiquitin system [BR:
ppyr04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
116178437
Cul7 complex
116178437
Chromosome and associated proteins [BR:
ppyr03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
116178437
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
116178437
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
DUF4073
Motif
Other DBs
NCBI-GeneID:
116178437
NCBI-ProteinID:
XP_031353787
LinkDB
All DBs
Position
Unknown
AA seq
162 aa
AA seq
DB search
MPNIKLQSSDGETFEIDVEIAKCSVTIKTMLEDLGMDDDEEEIVPLPNVNSAILKKVIQW
ATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFTASEEEQVRKENEWCEEK
NT seq
489 nt
NT seq
+upstream
nt +downstream
nt
atgcccaacatcaaattgcaatcctccgatggcgagacgttcgaaatcgacgtcgagata
gcgaaatgctccgttacaattaaaaccatgttggaagatttaggaatggacgatgacgaa
gaagaaatcgttccgctacctaacgtcaactcggcgattctaaagaaagtcatccaatgg
gccacgtaccacaaagacgaccctccgccaccggaagacgatgagaataaagaaaaacgc
accgacgatatctcttcgtgggacgccgactttctgaaagtcgaccagggtactctcttc
gaattgatcctagccgccaattacctcgacatcaagggactgttagatgtaacgtgtaag
actgtcgccaatatgattaaggggaagacgccagaggagattcgcaaaacgttcaatatc
aaaaatgactttaccgcctccgaagaggagcaggtgcgtaaagaaaatgaatggtgcgag
gagaaataa
DBGET
integrated database retrieval system