Pseudomonas poae: H045_03265 Help Entry H045_03265        CDS       T02456                                  Name (GenBank) cell division protein   KO K05589   cell division protein FtsB Organism ppz  Pseudomonas poae Brite KEGG Orthology (KO) [BR:ppz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppz03036]     H045_03265 Chromosome and associated proteins [BR:ppz03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     H045_03265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC ACCA_BT Motif Other DBs NCBI-ProteinID:  AGE24729 LinkDB All DBs Position 713361..713639 Genome browser AA seq 92 aa AA seqDB search MRSPNWLFLVLLLLLAGLQYRLWVGNGSFAQVKDLTEQIAAQHAENEILLERNRVLDAEV LELKKGTETVEERARHELGMVKEGETLYQLAQ NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcagtcccaattggttgttcctcgtcttgctcttgttgctggctggcctgcagtac cgcctatgggtgggtaatggcagctttgcgcaggtaaaagacctgactgagcaaattgct gcacagcacgccgaaaacgaaatcctgctggagcgcaatcgcgtcctcgatgccgaagtg ctcgagctgaaaaaaggcacggagaccgttgaagaacgggctcgtcatgaattgggtatg gtcaaggagggcgagaccctctaccagctggcccaatga

DBGET integrated database retrieval system