Pseudomonas poae: H045_14590 Help Entry H045_14590        CDS       T02456                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppz  Pseudomonas poae Pathway ppz00998   Biosynthesis of various antibiotics ppz01100   Metabolic pathways ppz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H045_14590 (acpP)    00074 Mycolic acid biosynthesis     H045_14590 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H045_14590 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AGE26983 LinkDB All DBs Position complement(3346799..3347035) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaactgggcgttaaggaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttaccagccaccaggcgtaa

DBGET integrated database retrieval system