Pseudomonas poae: H045_23055 Help Entry H045_23055        CDS       T02456                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppz  Pseudomonas poae Pathway ppz00998   Biosynthesis of various antibiotics ppz01100   Metabolic pathways ppz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H045_23055    00074 Mycolic acid biosynthesis     H045_23055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H045_23055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGE28669 LinkDB All DBs Position complement(5257069..5257338) Genome browser AA seq 89 aa AA seqDB search MSDQQRLERDIKMLIIEALGLEDISVDDIDSEQTLFGEGLGLDSVDALELGLAIQKTYGI KIDADAKDTRNHFTNVACLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgaccaacaacgccttgaacgcgacataaagatgctgatcattgaggccctgggc ctggaagacatcagcgtcgatgacattgacagcgaacagaccctgttcggcgaaggcctg ggcctggattcggtcgatgccctggaattgggcctggcgatccagaaaacctacggcatc aagatcgatgccgacgccaaggacacccgcaaccacttcaccaacgtggcctgccttgcg gcgttcgtcacagccagacaggcagcttga

DBGET integrated database retrieval system