KEGG   Pseudomonas qingdaonensis: KH389_23130
Entry
KH389_23130       CDS       T07622                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
pqi  Pseudomonas qingdaonensis
Brite
KEGG Orthology (KO) [BR:pqi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pqi03016]
    KH389_23130 (truB)
Enzymes [BR:pqi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     KH389_23130 (truB)
Transfer RNA biogenesis [BR:pqi03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    KH389_23130 (truB)
 Prokaryotic type
    KH389_23130 (truB)
SSDB
Motif
Pfam: TruB_N TruB-C_2 TruB_C_2 PUA_3 LRR_FBXL18 HTH_CodY
Other DBs
NCBI-ProteinID: QVL18246
UniProt: A0ABX8DPN7
LinkDB
Position
complement(5066478..5067395)
AA seq 305 aa
MAQVKRIRRNVSGIILLDKPLGFTSNAALQKVRWLLNAEKAGHTGSLDPLASGVLPLCFG
EATKFSQYLLESDKGYETVMQLGQTTNTGDAEGEILQTREVTVGRSDVEAVLPQFRGPIS
QIPPMYSALKRDGQPLYKLARAGEVVEREARSVTINRLELLECEGTRVRLSVGCSKGTYI
RTLVEDIGEQLGCGAYVAELRRTHAGPFELAQTVTLEELEQVHAEGGNEAVDRFLMPSDS
GLQDWPLLHFSEHSAFYWLHGQPVRAPDAPKFGMVRVQDHNGRFIGIGEVSEDGRIAPRR
LIRSE
NT seq 918 nt   +upstreamnt  +downstreamnt
gtggctcaggtcaagcgtatccgtcgtaacgtcagcggcatcatcctgctcgacaagccg
ttggggttcacctccaatgctgccctgcagaaggtgcgctggctgctcaacgccgagaag
gccggacataccggcagcctcgacccgctggccagtggcgtgctgccgctgtgcttcggc
gaggcgaccaagttctcgcaatacctgctcgagtccgacaagggctacgagacggtgatg
caactggggcagaccaccaacacgggcgacgccgaaggcgaaattctgcaaacccgcgaa
gtgaccgttggtcgcagcgacgttgaagccgtactgccacagtttcgtggtccaatcagc
cagataccgccgatgtactcggcgctcaagcgcgatggccagccgctgtacaagctggca
cgtgcaggcgaagtagtggagcgtgaagcgcgttctgttactattaaccgcttggagctg
ctcgagtgcgaaggcacccgggtacgcctctcggtaggctgcagcaagggcacctacatc
cgtacgctggtagaggacatcggtgagcagctgggctgcggcgcctatgttgcagaactg
cgccgcacgcatgcaggccccttcgaactggcccagaccgtcaccctcgaagagctcgag
caggtgcacgccgaaggtggcaacgaagcggtcgaccgcttcctgatgccatcggacagc
gggttgcaggactggccgttgctgcacttctccgagcacagcgcgttctactggctgcat
ggtcagccggtgcgtgcaccggatgcgccgaagttcggcatggtccgcgtgcaggatcac
aacggtcgtttcatcggtatcggtgaagtgagcgaagacgggcgcattgcgccacgtcga
ctgattcggtcggaatga

DBGET integrated database retrieval system