Podarcis raffonei (Aeolian wall lizard): 128399944 Help Entry 128399944         CDS       T09310                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04060   Cytokine-cytokine receptor interaction praf04218   Cellular senescence praf04620   Toll-like receptor signaling pathway praf04621   NOD-like receptor signaling pathway praf04622   RIG-I-like receptor signaling pathway praf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:praf00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     128399944  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     128399944  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128399944    04621 NOD-like receptor signaling pathway     128399944    04622 RIG-I-like receptor signaling pathway     128399944  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128399944  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:praf04052]     128399944    00536 Glycosaminoglycan binding proteins [BR:praf00536]     128399944 Cytokines and neuropeptides [BR:praf04052]  Cytokines   Chemokines    128399944 Glycosaminoglycan binding proteins [BR:praf00536]  Heparan sulfate / Heparin   Chemokines    128399944 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Dendrin Motif Other DBs NCBI-GeneID:  128399944 NCBI-ProteinID:  XP_053217821 LinkDB All DBs Position 13:11068849..11072530 Genome browser AA seq 104 aa AA seqDB search MNSKVVVAVLALFVLSSSLTEGVSLARIGSELRCQCISTHSTFIPTRHIQDVKLTQSGPH CKNVEIIATLKDGKEVCLEPTARWVKVIIKAILDKAQASAESQL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaactccaaggttgttgttgcagttctggctcttttcgtgctctccagctctctgacg gaaggtgtctcactggcccggatcgggagcgagctgcgctgccaatgcataagcacccat tccacgttcatcccgaccagacacattcaggatgtcaaactcacccaaagcggaccccac tgcaagaacgtcgaaatcattgctactcttaaggacgggaaagaagtatgcttggagccc acagctagatgggtgaaagtgatcatcaaagccatccttgataaggctcaagccagtgca gaatcccagctataa

DBGET integrated database retrieval system