Podarcis raffonei (Aeolian wall lizard): 128400239 Help Entry 128400239         CDS       T09310                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:praf00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128400239 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:praf04121]     128400239 (ELOB)    03400 DNA repair and recombination proteins [BR:praf03400]     128400239 (ELOB) Ubiquitin system [BR:praf04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      128400239 (ELOB)    Cul5 complex      128400239 (ELOB) DNA repair and recombination proteins [BR:praf03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128400239 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  128400239 NCBI-ProteinID:  XP_053218331 LinkDB All DBs Position 13:34899757..34905263 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVYELKRIVEGILKRPPEEQRLYKDDQLLDDSKTLGDC GFTSQTARPQAPATVGLAFRASEDAFEPLRIDPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttttaatgatccgacgtcacaagacgaccatcttcacagacgccaaggag tccagtacggtgtatgagctgaaaagaattgttgaggggatacttaagagacccccagaa gaacaaaggctatacaaggatgaccaactgttggatgacagcaaaaccctcggagactgt ggcttcaccagccagacagcacgacctcaggccccagcaacagttggcttggccttcaga gccagtgaagatgcctttgagcccctccgcattgatcccttctccagccccccggagctc ccagacgtgatgaagccccaggactctggcagcagcgccaacgagcaagcggtgcagtga

DBGET integrated database retrieval system