Podarcis raffonei (Aeolian wall lizard): 128402570 Help Entry 128402570         CDS       T09310                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04010   MAPK signaling pathway praf04068   FoxO signaling pathway praf04081   Hormone signaling praf04114   Oocyte meiosis praf04140   Autophagy - animal praf04150   mTOR signaling pathway praf04810   Regulation of actin cytoskeleton praf04910   Insulin signaling pathway praf04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:praf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128402570 (INS)    04068 FoxO signaling pathway     128402570 (INS)    04150 mTOR signaling pathway     128402570 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     128402570 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128402570 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     128402570 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128402570 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     128402570 (INS)    04914 Progesterone-mediated oocyte maturation     128402570 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:praf04052]     128402570 (INS) Cytokines and neuropeptides [BR:praf04052]  Neuropeptides   Unclassified    128402570 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  128402570 NCBI-ProteinID:  XP_053222769 LinkDB All DBs Position 1:74002479..74007174 Genome browser AA seq 107 aa AA seqDB search MTLWIRSLPLLALLAVSAPTTSYAVPNQHLCGSHLVEALYLVCGERGFYYSPKTRRNVEQ PLVNGPLQNEVEALPFQPQDFEKVKRGIVQQCCQNSCSLYDLESYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgactctctggatcagatctctgcctctcctagcgctgcttgctgtttcagctcctact actagttatgctgttcccaatcagcacctatgtggctcccatctagtggaagcactctac cttgtatgtggagaacgaggtttctactattcccccaaaacacggcggaatgttgaacag cccctagtgaacgggcctttacagaatgaagtggaagcactgccattccaaccacaggac tttgagaaggtgaagagaggaattgtgcagcaatgttgtcaaaactcctgctccctctat gatctagagagctactgcaactaa

DBGET integrated database retrieval system