Podarcis raffonei (Aeolian wall lizard): 128407101 Help Entry 128407101         CDS       T09310                                  Name (RefSeq) histone H2A type 2-C   KO K11251   histone H2A Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf03082   ATP-dependent chromatin remodeling praf04217   Necroptosis Brite KEGG Orthology (KO) [BR:praf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     128407101  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     128407101  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:praf03036]     128407101   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:praf04147]     128407101 Chromosome and associated proteins [BR:praf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     128407101 Exosome [BR:praf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128407101 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  128407101 NCBI-ProteinID:  XP_053231051 LinkDB All DBs Position 2:complement(15713760..15714304) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKNK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcgggaaacaaggaggcaaagctcgggctaaggccaagtctcgctcttcg cgggccggcctgcagttccccgtcggccgcgtgcaccgcctgcttcggaaaggcaactac gccgagagagtcggtgccggggctccggtttacatggctgccgtgctcgaatatctgacc gccgagatcctggagctggcgggcaacgcggcccgagacaacaagaagacgcgcatcatc cctcgtcacctgcagctcgccattcgcaatgacgaggagctgaacaaactcctgggcaaa gtgaccatcgcgcagggcggagtcttgccaaacatccaggctgtgctgttgcccaagaag accgaaagccacaaggcgaaaaacaagtaa

DBGET integrated database retrieval system