Podarcis raffonei (Aeolian wall lizard): 128410702 Help Entry 128410702         CDS       T09310                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04814   Motor proteins praf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:praf00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     128410702 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128410702 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:praf03037]     128410702 (DYNLT1)    04812 Cytoskeleton proteins [BR:praf04812]     128410702 (DYNLT1) Cilium and associated proteins [BR:praf03037]  Motile cilia and associated proteins   Dynein arm    128410702 (DYNLT1) Cytoskeleton proteins [BR:praf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      128410702 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  128410702 NCBI-ProteinID:  XP_053238265 LinkDB All DBs Position 3:complement(71176578..71182331) Genome browser AA seq 113 aa AA seqDB search MDELQSAEETAFIVDEVSNIIKEAIEGTIGGNAYLHSKVNQWTTSVVEQILSHLTKLGKP FKYVVTCVIMQKNGAGLHTASSCFWDNSADGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgagcttcagtctgcagaggagactgcgtttattgtggatgaagtaagcaacatt ataaaagaggccatagaaggaacaataggtggcaatgcatatctgcacagcaaagtgaat cagtggactacaagtgttgtagagcaaattctgagtcatctcacaaagctggggaaacct ttcaaatatgttgtgacatgtgtgattatgcaaaagaatggtgctggacttcatactgca agctcttgcttctgggacaactctgctgatggaacctgcactgtgagatgggagaacaag actatgtactgtatcgtcagtgcctttggactcgcaatataa

DBGET integrated database retrieval system