Podarcis raffonei (Aeolian wall lizard): 128412157 Help Entry 128412157         CDS       T09310                                  Name (RefSeq) cystatin-A-like   KO K13907   cystatin-A/B Organism praf  Podarcis raffonei (Aeolian wall lizard) Brite KEGG Orthology (KO) [BR:praf00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:praf01002]     128412157   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:praf04147]     128412157 Peptidases and inhibitors [BR:praf01002]  Peptidase inhibitors   Family I25: cystatin family    128412157 Exosome [BR:praf04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128412157 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin SQAPI Dynein_light Motif Other DBs NCBI-GeneID:  128412157 NCBI-ProteinID:  XP_053240996 LinkDB All DBs Position 4:1542650..1545677 Genome browser AA seq 95 aa AA seqDB search MSLGGLSPTQPATPEIQAIADQVKCQLEAKVNQAFNLFEVTEFRTQVVAGTNYFLKVRYA EDKYAHLRVFQNLSGDLTLHGYELNHTRTDPINYF NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagtcttggaggattatcccccacccaaccggccactcctgagattcaggccatcgct gaccaggtgaaatgtcagctggaagcaaaagtgaaccaggcattcaacctctttgaggtc actgagttcaggactcaggtggtggctggcaccaactacttcctcaaggtccggtatgcg gaggacaaatacgcccaccttcgtgtgttccagaacctttcaggcgatctcacgctccac ggctacgagctgaaccacaccaggacggaccccatcaactacttctag

DBGET integrated database retrieval system