Podarcis raffonei (Aeolian wall lizard): 128416210 Help Entry 128416210         CDS       T09310                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04010   MAPK signaling pathway praf04012   ErbB signaling pathway praf04068   FoxO signaling pathway praf04137   Mitophagy - animal praf04140   Autophagy - animal praf04150   mTOR signaling pathway praf04210   Apoptosis praf04218   Cellular senescence praf04370   VEGF signaling pathway praf04371   Apelin signaling pathway praf04540   Gap junction praf04625   C-type lectin receptor signaling pathway praf04810   Regulation of actin cytoskeleton praf04910   Insulin signaling pathway praf04912   GnRH signaling pathway praf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:praf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128416210 (NRAS)    04012 ErbB signaling pathway     128416210 (NRAS)    04370 VEGF signaling pathway     128416210 (NRAS)    04371 Apelin signaling pathway     128416210 (NRAS)    04068 FoxO signaling pathway     128416210 (NRAS)    04150 mTOR signaling pathway     128416210 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     128416210 (NRAS)    04137 Mitophagy - animal     128416210 (NRAS)   09143 Cell growth and death    04210 Apoptosis     128416210 (NRAS)    04218 Cellular senescence     128416210 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     128416210 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128416210 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128416210 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128416210 (NRAS)    04912 GnRH signaling pathway     128416210 (NRAS)    04916 Melanogenesis     128416210 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:praf04131]     128416210 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:praf04147]     128416210 (NRAS)    04031 GTP-binding proteins [BR:praf04031]     128416210 (NRAS) Membrane trafficking [BR:praf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128416210 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128416210 (NRAS) Exosome [BR:praf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128416210 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    128416210 (NRAS)   Exosomal proteins of breast cancer cells    128416210 (NRAS)   Exosomal proteins of colorectal cancer cells    128416210 (NRAS) GTP-binding proteins [BR:praf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128416210 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  128416210 NCBI-ProteinID:  XP_053249542 LinkDB All DBs Position 6:complement(65875907..65884759) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAHEVAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKRLNSSEDGNQG CMGLSCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaagctggtggtggtaggagctggtggtgttgggaaaagtgccctaacc atccagctcatccagaatcactttgtagatgaatatgatcccactatagaggactcttac cgtaaacaggtagttattgatggagagacctgtttgttagatatcctggacaccgcaggg caagaagagtatagcgccatgagagatcagtacatgagaactggggaaggctttctatgt gtgttcgccatcaacaacagcaaatcatttgcagatatcaatctttacagagagcagatt aaaagagtgaaagattctgaagacgtaccaatggtgttagtgggaaacaaatgcgacttg ccaacacggacagtagataccaaacaagctcatgaagtagccaagagctatgggattccc ttcattgagacatctgccaaaacgagacagggtgttgaagatgccttttacacactggtg agggagatccgccaatatcggatgaaaagactcaacagcagtgaagatgggaatcaaggc tgcatgggactctcgtgccttgtgatgtga

DBGET integrated database retrieval system