Pieris rapae (cabbage white): 110992056 Help Entry 110992056         CDS       T05162                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism prap  Pieris rapae (cabbage white) Pathway prap04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:prap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110992056  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:prap04121]     110992056    03400 DNA repair and recombination proteins [BR:prap03400]     110992056 Ubiquitin system [BR:prap04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110992056    Cul5 complex      110992056 DNA repair and recombination proteins [BR:prap03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110992056 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110992056 NCBI-ProteinID:  XP_022113410 LinkDB All DBs Position 8:10727420..10730181 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRKKLTIFTDAKDTTTVLELKKMIEGILKVPPPSQMLFNKDSQLMEDEKTLAE YALTSVTARAQCPAPIGLALRKENGEFEALDLTPYSSPPDLPDVMKSQEANGQEQMDQH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtctttttaatgattaggcgaaaaaaattaaccatcttcacggatgccaaggat actacgactgtattagaacttaagaaaatgattgaaggcattttaaaagttccaccacct agtcagatgctgtttaataaagacagtcagttgatggaagatgaaaaaaccctagcagaa tatgccttaacctcagttactgctagagcacaatgccccgcaccaattggacttgctctc aggaaagaaaatggtgagtttgaagctctggatctcactccctattcttcaccaccagat ctgcccgatgtcatgaagtcacaggaagccaatggacaggaacagatggatcaacactaa

DBGET integrated database retrieval system