KEGG   Pieris rapae (cabbage white): 110994649
Entry
110994649         CDS       T05162                                 
Name
(RefSeq) cytochrome P450 306a1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
prap  Pieris rapae (cabbage white)
Pathway
prap00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:prap00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    110994649
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:prap00199]
    110994649
Enzymes [BR:prap01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     110994649
Cytochrome P450 [BR:prap00199]
 Cytochrome P450, animal type
  CYP306 family
   110994649
SSDB
Motif
Pfam: p450 Tox-HDC
Other DBs
NCBI-GeneID: 110994649
NCBI-ProteinID: XP_022117133
LinkDB
Position
7:complement(1611799..1619078)
AA seq 538 aa
MDFLFLWLVSFVIGFWINKKLRQWKNLPPGPWGLPVVGYLPFFDRNSPHLTLTKLAREYG
PIYSIKMGSIPTVVLSDHKLIREAFAKEDFSGRAPLYLTHGIMKGNGIICAEGALWKDQR
KLITTWLKSFGMSKHSLARDRLETRIASGVDELIQNVKESTGKPINLTEMVTNSLGNVVN
DIIFGYKYPQNDKTWIWFRQIQEEGCHEMGVAGVVNFLPFLRFFMPSIKVTMEVLTRGQA
QTHRLYASLIDKRRKLIGIPQPEKASYAAHENMFNEHPQGHIKCISYSKHSSNSEHYFDP
DVLHASKDECILDNFLKEQKRRYDANEDSAKYMSDEQLVYLLADMFGAGLDTTSVTIAWY
FLFMALYPEEQECVRKEIMTVCPDETDIDHAKLPYMMATICETQRVRSIVPVGIPHGCVQ
DTYLGDYRITKGTMVVPLQWAVHMDPSTWEEPEKFRPSRFLDEDGNLLKPQEFIAFQTGK
RMCPGDELSRMISVGLIARFFKTFKLRLASDPPTEEEMMGKVGLTLSPPETKYFCDLI
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggatttcctctttctttggctagtgagctttgtcataggtttctggataaacaaaaaa
cttaggcaatggaagaatcttccgccagggccttgggggttaccagttgtcggttatctg
ccattcttcgaccgcaacagcccccacttaaccctaacgaagctggcaagggaatacggt
ccgatctattccattaagatggggagtattcctactgtagttctttcggaccacaaatta
attagggaggccttcgctaaagaggacttttcgggtcgtgcgcctttgtacctgacccac
ggcatcatgaaaggcaatggtatcatttgcgctgagggtgctctgtggaaagatcaacgc
aagctgataacgacatggcttaaaagctttggtatgagcaagcacagccttgcgcgtgat
cgattggagaccagaatcgcttctggcgttgacgagttgatacaaaatgttaaagaatct
actggaaaacctataaatttgacagaaatggtaacaaattctcttgggaatgttgtaaac
gatattatatttgggtataaatatccgcaaaatgataaaacatggatctggtttagacaa
atacaagaggaaggctgccatgaaatgggtgtggctggtgttgtgaactttctaccattt
ctacggtttttcatgccatcaataaaagtgacgatggaggtactgacacgtgggcaggct
cagacccacagactatacgccagccttatagacaagcgtcgtaagctaatcggaatcccg
caaccggaaaaggcgtcctatgcggcgcacgaaaacatgttcaatgaacacccacaaggc
cacatcaaatgcataagctacagtaaacattcatctaactcggaacattattttgaccca
gacgttcttcacgcttctaaagacgaatgcattcttgacaattttctgaaagagcaaaaa
aggcggtatgacgcaaacgaagattccgcaaagtatatgagcgatgaacaattggtgtat
cttttagctgatatgtttggggctgggcttgatactacatcagttacgattgcttggtac
tttttatttatggcattatatcctgaagaacaggaatgtgttcgcaaggaaataatgact
gtatgcccggacgagactgatatagaccacgcaaagcttccttacatgatggcgacgata
tgtgaaactcaacgagtgcgctctatagttcccgttggaataccccatggttgtgtccag
gacacatatttaggtgattatcgaataaccaaaggtactatggttgttcccttgcaatgg
gcagtacatatggatccctcgacatgggaagagccagagaaatttcgcccttcacgcttt
ttggatgaagatgggaatttattaaaacctcaagaatttatagcctttcagacaggtaaa
cgaatgtgtccgggtgacgagctgtctcgaatgatatcagttggcctaattgcacgattt
ttcaaaaccttcaagcttcgactcgcttctgacccaccgacagaggaggaaatgatggga
aaagttggattgactctctctccaccagaaaccaaatacttttgtgatctcatatag

DBGET integrated database retrieval system