Pandoraea pnomenusa: X636_07520 Help Entry X636_07520        CDS       T02950                                  Name (GenBank) phenol hydroxylase   KO K16249   phenol/toluene 2-monooxygenase (NADH) P0/A0 Organism prb  Pandoraea pnomenusa Pathway prb00361   Chlorocyclohexane and chlorobenzene degradation prb00362   Benzoate degradation prb00623   Toluene degradation prb01100   Metabolic pathways prb01120   Microbial metabolism in diverse environments prb01220   Degradation of aromatic compounds Module prb_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:prb00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     X636_07520    00361 Chlorocyclohexane and chlorobenzene degradation     X636_07520    00623 Toluene degradation     X636_07520 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phenol_hyd_sub Motif Other DBs NCBI-ProteinID:  AHB75314 LinkDB All DBs Position 4709666..4709890 Genome browser AA seq 74 aa AA seqDB search MHKQAALEAEPRFDPNLRFVSVTAINTQGFVQFEFSVGTPELCVELMLPIAAFEEFCLAQ KVRRLDAFGEIVRH NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcacaagcaagcagcccttgaggcggaacccaggttcgatccgaacctcaggtttgtc agcgttaccgccatcaacacacagggattcgtccagttcgaattttcagtcggcaccccc gagctctgtgtcgagctcatgctgcctattgctgcgttcgaagaattttgcctcgcgcag aaggtgaggcgattggatgccttcggcgagattgtgcggcattga

DBGET integrated database retrieval system