Pandoraea pnomenusa: X636_22130 Help Entry X636_22130        CDS       T02950                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism prb  Pandoraea pnomenusa Brite KEGG Orthology (KO) [BR:prb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:prb03032]     X636_22130    03036 Chromosome and associated proteins [BR:prb03036]     X636_22130    03400 DNA repair and recombination proteins [BR:prb03400]     X636_22130 DNA replication proteins [BR:prb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     X636_22130 Chromosome and associated proteins [BR:prb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     X636_22130 DNA repair and recombination proteins [BR:prb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       X636_22130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG Motif Other DBs NCBI-ProteinID:  AHB77825 UniProt:  A0A378YB76 LinkDB All DBs Position complement(2473747..2474025) Genome browser AA seq 92 aa AA seqDB search MNKQELIDAVAGATGASKAQTGETIDTLIEVIKKAVAKGDTVQLIGFGSFGSGKRAARTG RNPKTGEAIKIPAAKTVKFTAGKAFKDAVNKK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaggaactgatcgacgccgtcgccggcgctacgggtgccagcaaggctcaa accggcgagaccatcgatacgctgatcgaggttatcaagaaagccgtcgccaagggtgat acggttcagttgatcggcttcggctcgttcggttcgggcaagcgtgccgcgcgtaccggc cgcaacccgaagaccggcgaagcgatcaagatcccggccgccaagaccgtgaagttcacg gctggcaaggcgttcaaggacgctgtgaacaagaagtaa

DBGET integrated database retrieval system