Pradoshia sp. D12: F7984_00730
Help
Entry
F7984_00730 CDS
T06218
Name
(GenBank) 50S ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
prd
Pradoshia sp. D12
Pathway
prd03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
prd00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
F7984_00730
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
prd03011
]
F7984_00730
Ribosome [BR:
prd03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
F7984_00730
Bacteria
F7984_00730
Archaea
F7984_00730
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID:
QFK69910
LinkDB
All DBs
Position
132649..133011
Genome browser
AA seq
120 aa
AA seq
DB search
MITKANKNATRKKRHARVRAKLAGTPSRPRLNVFRSNKHIYAQLIDDANGVTLASASTLD
KEISLESTSNVDAAKKVGEVIAKRAVEKGVSEVVFDRGGYLYHGRIQALADAARENGLQF
NT seq
363 nt
NT seq
+upstream
nt +downstream
nt
atgatcacgaaggctaacaaaaacgctactcgtaagaaaagacatgcacgtgtccgcgct
aaattagcgggtacaccgtctcgtccgcgtttaaatgttttccgatccaataagcacatt
tatgcacagcttattgatgatgctaatggtgttactttagctagtgcatcaacacttgat
aaagaaattagccttgagtccactagtaacgtggatgcagctaaaaaagttggcgaagta
atcgctaaacgtgctgtagaaaaaggtgtttccgaagttgtttttgaccgtggaggatac
ttatatcacggacgtatacaagcacttgcagatgctgcacgtgaaaacggattacaattc
taa
DBGET
integrated database retrieval system