Metapseudomonas resinovorans: PCA10_37910 Help Entry PCA10_37910       CDS       T02708                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pre  Metapseudomonas resinovorans Pathway pre01100   Metabolic pathways pre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PCA10_37910 (acpP)    00074 Mycolic acid biosynthesis     PCA10_37910 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PCA10_37910 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  BAN49523 UniProt:  S6ATU9 LinkDB All DBs Position complement(4159417..4159653) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEDEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYINAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaagaa gacgaagtaaccaacagcgcttccttcgttgaagacctgggcgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgagatcccggacgaacaagcc gagaagatcaccaccgttcaggaagccatcgactacatcaacgcccacgcgcagtaa

DBGET integrated database retrieval system