Metapseudomonas resinovorans: PCA10_p1140 Help Entry PCA10_p1140       CDS       T02708                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism pre  Metapseudomonas resinovorans Brite KEGG Orthology (KO) [BR:pre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pre03032]     PCA10_p1140 (hup)    03036 Chromosome and associated proteins [BR:pre03036]     PCA10_p1140 (hup)    03400 DNA repair and recombination proteins [BR:pre03400]     PCA10_p1140 (hup) DNA replication proteins [BR:pre03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     PCA10_p1140 (hup) Chromosome and associated proteins [BR:pre03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     PCA10_p1140 (hup) DNA repair and recombination proteins [BR:pre03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       PCA10_p1140 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG TrmB SNRNP27 Motif Other DBs NCBI-ProteinID:  BAN51498 UniProt:  S6AYA3 LinkDB All DBs Position pCAR1.3:96543..96818 Genome browser AA seq 91 aa AA seqDB search MNRQELVKAIADESGHSQSTVGEVLNSLISTVQNVVAGGDKVSLVGFGTFESTKQAERQG RNPSTGAPITIAASIKPKFTPGKSFKERVNQ NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaatcgtcaagaactcgtcaaagcgattgccgacgaaagcgggcacagtcagtcaacc gtgggagaggtgctgaatagccttatctcgacggttcaaaatgtcgttgccggcggcgac aaggttagcctcgtgggctttggtactttcgagtcaaccaagcaggccgagcgtcagggc cgtaatccgtctaccggggctccgatcaccatcgctgcctcgatcaagccaaagttcacc cctggcaagtccttcaaggaacgcgtcaaccagtaa

DBGET integrated database retrieval system