Plasmodium reichenowi: PRSY57_0726600 Help Entry PRSY57_0726600    CDS       T08079                                  Name (RefSeq) dynein light chain, putative   KO K10418   dynein light chain LC8-type Organism prei  Plasmodium reichenowi Pathway prei04145   Phagocytosis prei04517   IgSF CAM signaling prei04814   Motor proteins Brite KEGG Orthology (KO) [BR:prei00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PRSY57_0726600  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PRSY57_0726600   09142 Cell motility    04814 Motor proteins     PRSY57_0726600  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:prei03037]     PRSY57_0726600    04812 Cytoskeleton proteins [BR:prei04812]     PRSY57_0726600 Cilium and associated proteins [BR:prei03037]  Motile cilia and associated proteins   Dynein arm    PRSY57_0726600 Cytoskeleton proteins [BR:prei04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PRSY57_0726600 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  24530515 NCBI-ProteinID:  XP_012762373 UniProt:  A0A060RQN3 LinkDB All DBs Position 7:<1057760..>1058053 Genome browser AA seq 97 aa AA seqDB search MEEPKCDILYEHMNYENKIKLINIAKEIYININNNKINSWRNATIALRDKIKEVLDFNEK GWHIIIGSKFGFFCTHEIYHALHFKLDHIEFLIFKHG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggaagaacctaaatgtgatattttatatgaacatatgaattatgaaaataaaataaaa ttaattaacatagcaaaggaaatatatataaatataaataataataaaataaattcttgg agaaatgcaactatagctttaagagataaaataaaggaagttttagattttaacgaaaaa ggttggcatataataattggatccaaatttggatttttttgtactcatgaaatttatcat gctttgcattttaaattagatcatatagagttccttatttttaaacatggataa

DBGET integrated database retrieval system