Plasmodium reichenowi: PRSY57_1212900 Help Entry PRSY57_1212900    CDS       T08079                                  Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism prei  Plasmodium reichenowi Pathway prei04145   Phagocytosis prei04517   IgSF CAM signaling prei04814   Motor proteins Brite KEGG Orthology (KO) [BR:prei00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PRSY57_1212900  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PRSY57_1212900   09142 Cell motility    04814 Motor proteins     PRSY57_1212900  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:prei03037]     PRSY57_1212900    04812 Cytoskeleton proteins [BR:prei04812]     PRSY57_1212900 Cilium and associated proteins [BR:prei03037]  Motile cilia and associated proteins   Dynein arm    PRSY57_1212900 Cytoskeleton proteins [BR:prei04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PRSY57_1212900 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  24532185 NCBI-ProteinID:  XP_012764010 UniProt:  A0A060RVL4 LinkDB All DBs Position 12:<515905..>516186 Genome browser AA seq 93 aa AA seqDB search MADRKSNKNAVVKNVDMTEEMQIDAIDCANQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgatagaaaatctaataagaatgcagttgtaaaaaatgtagatatgacagaagaa atgcaaattgatgctattgattgtgctaatcaggccttacaaaaatataacgtcgaaaaa gatattgctgcacatattaaaaaagaatttgatagaaaatatgacccaacttggcactgt gttgtaggaagaaattttggatcttatgttactcacgaaaccaaaaattttatatatttt tatattggacaagtagctatattattatttaaatcgggatga

DBGET integrated database retrieval system