KEGG   Plasmodium relictum: PRELSG_0712900
Entry
PRELSG_0712900    CDS       T09405                                 
Symbol
PFK9
Name
(RefSeq) 6-phosphofructokinase, putative
  KO
K24182  6-phosphofructokinase [EC:2.7.1.11]
Organism
prel  Plasmodium relictum
Pathway
prel00010  Glycolysis / Gluconeogenesis
prel00030  Pentose phosphate pathway
prel00051  Fructose and mannose metabolism
prel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PRELSG_0712900 (PFK9)
   00030 Pentose phosphate pathway
    PRELSG_0712900 (PFK9)
   00051 Fructose and mannose metabolism
    PRELSG_0712900 (PFK9)
Enzymes [BR:prel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PRELSG_0712900 (PFK9)
SSDB
Motif
Pfam: PFK
Other DBs
NCBI-GeneID: 39735466
NCBI-ProteinID: XP_028532372
LinkDB
Position
7:complement(522615..526802)
AA seq 1395 aa
MNNFNVDINENKKPTVDSLVKTMSVILRDNKCNFNLEENEEQRDHEQKENNNQDSKMINC
LMEKLTTKKFLEEKETKNSFYLVDNENMKIKKLKEHGHSASLNDDLSPLQYERIKYIPTL
PKALSCEYQILEENHGDDFINKTDYEEVKKYLKNLDNLPMLNVKETNNSELFKGGNILKI
GIILSGGPAPGGHNVIAGIYDYIRRYNEQSQVIGFLGGIDGLYSKNYAIITDKMMNRFRN
LGGFNMLWSGRGKVKNKDDLIAIENIVSKLKLNGLVIIGGDGSNSNAALIAEYFCERKIP
ISVIGVPKTIDGDLKSEAIEISFGFDTATKTYSEVIGNLCTDVKTGHNVYHVVRVMGRSA
SHVVLECALQTRPNIVLIGEEVEQQNLSLKDIVKNIVNIILKRRSLNKNYGVILIPEGLI
EFVPEMKVLISELSVISKEGPFDPSKLKKSREIWDFLPSIIREQLLMDRESTGYIQVGKI
ATERLIIVLVESELAKMNDKNMNIQFMSHYLGYEGRCAIPSNFDCNYCYALGYNAALLID
HKKTGYMSIIQNLYDVYSNWVPAAIPFLRIMHVNKDNTGKVFPAVKRYLVDLNSPLFNVL
KEVRRMWSLYDLYRSPGPIQFNGSLSDSRCYTVKVPTKDTLLCRNSDDLQLIINLANKNN
KENNNNSSENELIDGDIKSNTSSNLKKKKDNLNNEGISNDMSVSATYDSQLNISINEKRD
SLNNVERDSELNISPDEVNKDFYALQCSNYKSLGCMSELQTSRLYNKLELPELCSDLKAK
VRAGKQYISNDPYTQKQILSNYPHMSYENKFQIQEIFHDKYATPISFEIKIGIVFLSRQA
PGAMNVLCGLYRRLKLLKGVCIAFYGLYGLLNNKYIIIDDDNIAKHLNQGGLELTGNSPE
HSLFDKENRNKVCETVTKLQLNGLVMPGSNITITEAALLSEYFLEKKIPTSVVGIPLTGS
NNLIHELIETCVGFDSSTKVYASLIGNVLTDAVSMPKYWHFIRLMGRSPSHEVLECALQT
HPNMVIISEEYGAADKTLWRVVQDIADVVCARAEIGKNYGTILIPDALLMHLPHMKILLS
EISDILNEASEKGQLAEARNELVNLSSTQNGESSIWVHKLTPWSLALLKTFPQFIIKELL
QVDLRSMRFETLETEQLLLQMVKEELQQRKQKGKYSGSFMGLTHFFGYQGRSSLPSEFDC
KLAYSYGHAASIVIESGLTGYIVSIRGLCGKVKDWKLFAIPFISLMKILPRGQENKYLKS
AYKGDLPVIPSAPVDLNGKAYRSLKIALQKWQMEDRFCNPGPIQFEGNASNYYNRILFEE
QSEYFEMLRYVECYANILKDTCRFGVSADYLKNVFVQLCGMLVLAYKPNDILSNMPYIGS
IEDYYDWENQRKRMN
NT seq 4188 nt   +upstreamnt  +downstreamnt
atgaataactttaatgtggatattaatgaaaataaaaagccaactgtggattcattagta
aaaactatgtctgtaatattgagagacaataaatgcaattttaatttagaagaaaatgaa
gaacagagagatcatgaacaaaaagaaaataataatcaagacagtaaaatgataaattgc
ttgatggagaagttaacaacaaaaaaatttttagaagaaaaggaaacaaaaaatagcttc
tatttagtagataatgaaaatatgaaaataaaaaaattaaaagaacatgggcactctgca
tcattaaatgatgatttgagtccattacaatatgaacgaataaaatatattccaacatta
ccaaaggcattatcgtgcgaatatcaaatattagaagaaaatcatggtgatgattttatt
aataaaactgattatgaagaggtaaaaaaatatttaaaaaatctagataatttaccaatg
ttaaatgtaaaagaaacaaataatagtgaattatttaaaggaggtaatatattaaaaata
ggaatcatattatcaggaggcccagcaccaggtggtcataatgttatagcaggaatttat
gactatataagaaggtataatgaacaatctcaagtcattggatttttaggaggaatagat
ggtttatatagtaaaaattacgctataattactgacaaaatgatgaatcgttttagaaat
ttaggtggtttcaatatgctttggtcaggtagggggaaagtaaaaaacaaagatgattta
attgctattgaaaatatagtttctaaattaaagttaaatggtttagtaattattggtggg
gatggttctaatagcaatgctgctttaatagcggaatatttctgtgagagaaaaatccct
atctccgttataggagtaccaaaaactattgatggtgatttaaaaagtgaagctattgaa
attagttttgggtttgatacagctacaaaaacatattctgaggttataggaaatttatgc
acagatgtaaaaacgggtcataatgtatatcatgttgttagggtaatgggaagatcagca
tctcacgtagttttagaatgcgctctacaaacaagacctaatatagttttaattggtgaa
gaagtagaacaacaaaatttatctcttaaagatatagttaaaaatattgttaatattatt
ttaaaaagaagatctttgaataaaaattacggggttatactaataccggaagggctaata
gaatttgttccagaaatgaaagttttaattagcgaattaagtgtaatttcaaaagaaggc
ccatttgatccttctaaattaaaaaaatccagagaaatatgggattttttacctagtatc
attagagaacaattgttgatggatagggaatctactggttatattcaagtaggaaaaatt
gccacagaaagattaataatagtccttgtagaatcagaactagccaaaatgaatgataaa
aatatgaatattcaattcatgtctcattatttaggttacgagggtagatgcgctattcca
tcgaattttgattgtaattattgttatgctcttggatataatgcagcattattaatagac
cataaaaaaacaggatatatgtctataatacaaaatctatatgatgtatatagtaattgg
gtacccgcagctattccatttttaagaattatgcatgttaacaaagataacacaggcaaa
gtatttccagcagttaaaagatatttagtagatttaaatagccctttatttaatgtgtta
aaagaagtaagaagaatgtggtctctttatgatttatatagatcaccagggcctattcaa
tttaatggtagtttaagtgattcacgttgctatacagtaaaagttcctacaaaagatact
ttactatgtagaaattctgatgatttgcaattaattataaacttagctaataaaaataac
aaagaaaacaacaataattcatcagaaaatgaattgatagatggagatataaaatcaaat
acttcatccaatttaaagaaaaaaaaagataacctaaacaacgaaggaatttctaatgat
atgagcgtaagtgcaacgtatgatagtcagttgaatatatctattaatgaaaagagagat
tcattaaataatgtagaaagggatagtgaacttaacattagtcctgatgaagtaaataaa
gatttttatgcattacagtgttctaattataagtcattaggctgtatgtcggaattacaa
acttcaaggttatataataaattggagttaccagagttgtgttctgatttaaaagcaaaa
gtaagagcaggaaagcagtatatatctaatgatccatatacacaaaagcaaattttgtcg
aattatcctcatatgtcttatgaaaataaatttcaaattcaagaaatattccatgataaa
tatgcaactcctatatcctttgaaataaaaataggaatagtatttttatcgagacaagct
ccaggtgcaatgaatgtgttatgcggtctgtacaggcgtttaaaattattaaagggtgta
tgtattgctttttatggtctatatggattattaaataataaatatataataatagatgat
gataatatagccaagcatttaaatcaaggtggtttagaattaacaggtaattctcctgaa
cattccttatttgataaagagaatagaaataaggtatgtgaaacagtaactaaattgcaa
ttaaatggtttggttatgcctggttctaatattactataacagaggcagcattattatct
gaatattttttagaaaaaaaaatcccaacttctgttgttggtattcctttaactggttct
aataatttaattcatgaattaattgaaacttgtgttggttttgatagtagtactaaagtt
tatgcatcattaataggaaatgtattaacagatgctgtaagtatgcctaaatattggcat
tttattcgtttaatgggccgatctccatctcatgaagtactagaatgcgccttacagacc
catccaaatatggttataatatcagaggaatatggagcagctgataaaacattatggaga
gttgttcaggatattgctgatgtagtttgcgcaagagcagaaataggaaaaaattatggt
actatactaatacctgatgcattacttatgcatttaccacatatgaaaatattattgtca
gaaattagtgatatattaaatgaggcatcagaaaaaggacaattagctgaagctagaaat
gagttggtaaatttatcaagtacacaaaatggggaatcatctatatgggttcataagtta
acaccatggagtttagcattattaaaaacatttcctcagtttataattaaagaattatta
caagtagatttaagatctatgcgttttgagactctagaaacagaacaattattattacaa
atggttaaagaagagttacaacagagaaaacaaaaaggaaaatattcaggtagttttatg
ggattaactcatttttttggatatcaaggtcgttcttctttaccttctgaatttgattgc
aagctagcttattcatatggtcacgcagcatctattgtaattgaaagtggtttaactgga
tatattgtttctataaggggattatgtggtaaggtaaaagattggaagctttttgctatt
ccttttatttctttaatgaaaatattacctagaggccaagaaaataaatatctaaaaagt
gcttataaaggtgacttacctgttatacctagtgccccagttgatttaaatggaaaagca
tacagaagtttaaagattgctttacaaaaatggcaaatggaagatcgtttttgtaatcct
ggacctatacaatttgaaggaaatgcatctaattattataaccgaattttatttgaggag
cagtcagaatattttgagatgttaagatatgttgaatgctatgcaaatatcttaaaagac
acttgtcgttttggagtttcagctgattacttaaaaaatgtttttgtacaattatgtggt
atgctagtactagcttataaaccaaatgatatcttgtcaaatatgccctacattggcagt
attgaggattattatgattgggaaaatcaaagaaaaagaatgaactaa

DBGET integrated database retrieval system