Plasmodium relictum: PRELSG_1429700 Help Entry PRELSG_1429700    CDS       T09405                                  Symbol DLC8 Name (RefSeq) dynein light chain 1, putative   KO K10418   dynein light chain LC8-type Organism prel  Plasmodium relictum Pathway prel04145   Phagocytosis prel04517   IgSF CAM signaling prel04814   Motor proteins Brite KEGG Orthology (KO) [BR:prel00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PRELSG_1429700 (DLC8)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     PRELSG_1429700 (DLC8)   09142 Cell motility    04814 Motor proteins     PRELSG_1429700 (DLC8)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:prel03037]     PRELSG_1429700 (DLC8)    04812 Cytoskeleton proteins [BR:prel04812]     PRELSG_1429700 (DLC8) Cilium and associated proteins [BR:prel03037]  Motile cilia and associated proteins   Dynein arm    PRELSG_1429700 (DLC8) Cytoskeleton proteins [BR:prel04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PRELSG_1429700 (DLC8) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light CotJB Motif Other DBs NCBI-GeneID:  39738729 NCBI-ProteinID:  XP_028535085 UniProt:  A0A1J1HFC6 LinkDB All DBs Position 14:<1092386..>1092667 Genome browser AA seq 93 aa AA seqDB search MADRKANKNAVVKNVDMTEEMQIDAIDCASQALQKYNVEKDIAAHIKKEFDRKYDPTWHC VVGRNFGSYVTHETKNFIYFYIGQVAILLFKSG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctgatagaaaagcaaataaaaatgcagttgtaaaaaatgtagatatgaccgaagaa atgcaaattgatgctattgattgtgcaagtcaagctttacaaaaatacaatgttgaaaag gacatcgctgctcatataaaaaaagaatttgatagaaaatatgatcccacttggcattgt gtagtaggaagaaattttggttcttatgtcactcatgaaactaaaaattttatttatttt tatattggacaagtagctatattactgtttaaatccggataa

DBGET integrated database retrieval system