Poecilia reticulata (guppy): 103460785 Help Entry 103460785         CDS       T05149                                  Name (RefSeq) histone H2B.3   KO K11252   histone H2B Organism pret  Poecilia reticulata (guppy) Brite KEGG Orthology (KO) [BR:pret00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pret03036]     103460785   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pret04147]     103460785 Chromosome and associated proteins [BR:pret03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103460785 Exosome [BR:pret04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103460785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa LonB_AAA-LID DUF1931 Motif Other DBs NCBI-GeneID:  103460785 NCBI-ProteinID:  XP_008401314 LinkDB All DBs Position Unknown AA seq 67 aa AA seqDB search MSIMNSFVNDIFERIASEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAV TKYTSSK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcctccgaggcttcc cgcctggctcactacaacaagcgctccaccatcacctccagggagatccagacggccgtg cgcctcctgctgcccggagagctggccaagcacgccgtgtccgagggcaccaaggcggtc accaagtacaccagctccaagtaa

DBGET integrated database retrieval system