Poecilia reticulata (guppy): 103464544 Help Entry 103464544         CDS       T05149                                  Symbol brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism pret  Poecilia reticulata (guppy) Pathway pret04810   Regulation of actin cytoskeleton pret05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pret00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103464544 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103464544 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  103464544 NCBI-ProteinID:  XP_008406940 UniProt:  A0A3P9N788 LinkDB All DBs Position LG5:4733439..4735004 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctggccaggaagatcccgtacagagagagattcatcaagattgggcaaatcgagag tacatagaagtgattactagcagcattaagaaaattgctgacttcctcaactcgtttgat atgtcttgtcggtctcgtctggccaccctcaacgaaaagctaacagcgttggagagaagg attgaatacatagaggcaagagtgaccaaaggagagaccctgacctag

DBGET integrated database retrieval system