Poecilia reticulata (guppy): 103465062 Help Entry 103465062         CDS       T05149                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism pret  Poecilia reticulata (guppy) Pathway pret04137   Mitophagy - animal pret04140   Autophagy - animal pret04144   Endocytosis pret04145   Phagosome pret04148   Efferocytosis pret05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pret00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103465062    04145 Phagosome     103465062    04140 Autophagy - animal     103465062    04137 Mitophagy - animal     103465062    04148 Efferocytosis     103465062  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103465062  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pret04131]     103465062   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pret04147]     103465062    04031 GTP-binding proteins [BR:pret04031]     103465062 Membrane trafficking [BR:pret04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     103465062 Exosome [BR:pret04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103465062   Exosomal proteins of other body fluids (saliva and urine)    103465062   Exosomal proteins of colorectal cancer cells    103465062   Exosomal proteins of bladder cancer cells    103465062 GTP-binding proteins [BR:pret04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     103465062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 AAA_5 G-alpha ATPase_2 NACHT NB-ARC SRPRB AAA_14 ATP-synt_ab MCM ABC_tran Motif Other DBs NCBI-GeneID:  103465062 NCBI-ProteinID:  XP_008407826 UniProt:  A0A3P9PWT1 LinkDB All DBs Position LG5:complement(15992605..16000842) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVPTKRAQLWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERARPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttctactcaaagtcatcatccttggagactctggagttggg aagacttctctaatgaaccagtatgtgaataagaagttcagcaaccagtacaaagccacg attggcgccgatttcctgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtctttgggtgtagctttctaccgtgga gcagactgctgtgtgctggtgttcgatgtgaccgcacccaacaccttcaagaccctagac agctggagagacgagttcttgatccaggccagcccacgagacccagagaatttccctttt gtggtgctgggcaacaagattgacctggagaacagacaggtaccaaccaagcgggcacag ctttggtgtcagagcaagaacaacatcccgtatttcgagaccagcgccaaggaggcaatc aacgtggagcaggccttccagactatcgcacgcaatgctcttaaacaggaaaccgaagtg gagttgtacaatgagttccccgagccaataaagctggacaggaacgagcgagccaggcct tcagcagagacctgcagctgctga

DBGET integrated database retrieval system