Poecilia reticulata (guppy): 103465141 Help Entry 103465141         CDS       T05149                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism pret  Poecilia reticulata (guppy) Pathway pret04081   Hormone signaling pret04144   Endocytosis pret04150   mTOR signaling pathway pret04270   Vascular smooth muscle contraction pret04310   Wnt signaling pathway pret04350   TGF-beta signaling pathway pret04510   Focal adhesion pret04517   IgSF CAM signaling pret04519   Cadherin signaling pret04520   Adherens junction pret04530   Tight junction pret04621   NOD-like receptor signaling pathway pret04625   C-type lectin receptor signaling pathway pret04810   Regulation of actin cytoskeleton pret05100   Bacterial invasion of epithelial cells pret05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pret00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     103465141    04350 TGF-beta signaling pathway     103465141    04150 mTOR signaling pathway     103465141   09133 Signaling molecules and interaction    04081 Hormone signaling     103465141    04517 IgSF CAM signaling     103465141    04519 Cadherin signaling     103465141  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103465141   09144 Cellular community - eukaryotes    04510 Focal adhesion     103465141    04520 Adherens junction     103465141    04530 Tight junction     103465141   09142 Cell motility    04810 Regulation of actin cytoskeleton     103465141  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103465141    04625 C-type lectin receptor signaling pathway     103465141   09153 Circulatory system    04270 Vascular smooth muscle contraction     103465141  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103465141    05100 Bacterial invasion of epithelial cells     103465141  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pret04131]     103465141   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pret04147]     103465141    04031 GTP-binding proteins [BR:pret04031]     103465141 Membrane trafficking [BR:pret04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103465141 Exosome [BR:pret04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103465141   Exosomal proteins of other body fluids (saliva and urine)    103465141   Exosomal proteins of colorectal cancer cells    103465141   Exosomal proteins of bladder cancer cells    103465141 GTP-binding proteins [BR:pret04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103465141 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103465141 NCBI-ProteinID:  XP_008407966 UniProt:  A0A3P9NF17 LinkDB All DBs Position LG5:complement(22577327..22583772) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDDHTRRELAKMKQEPVKPEDGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKSNKCVLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagcaattaggaaaaagctggttatagtgggagatggagcctgtgggaagacctgc ctgctcattgtgttcagcaaggaccagtttcctgaagtctacgtgcccacagtgtttgag aactacgtcgctgacattgaagttgacgggaaacaggttgaattagcgctctgggacaca gcaggtcaagaggactatgaccgactccgcccactctcttatccagacactgatgtcata ctcatgtgcttctccattgacagcccagacagtcttgagaacatccctgagaagtggacc cccgaggtgaaacacttctgccccaacgttcccatcatactggtgggaaataaaaaggat ttgcgcaacgatgatcacactcggagggagctagctaaaatgaagcaggaacccgtgaaa ccagaagatggccgggatatggccaacaggatcggtgccttcggatacatggagtgctct gcaaaaacaaaggatggcgtgagggaagtgttcgagatggccaccagggctgcactacag gccaggcggggaaagaagagcaataaatgcgtcctactgtaa

DBGET integrated database retrieval system