Poecilia reticulata (guppy): 103466826 Help Entry 103466826         CDS       T05149                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism pret  Poecilia reticulata (guppy) Brite KEGG Orthology (KO) [BR:pret00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pret03019]     103466826    03029 Mitochondrial biogenesis [BR:pret03029]     103466826 Messenger RNA biogenesis [BR:pret03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103466826 Mitochondrial biogenesis [BR:pret03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     103466826 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  103466826 NCBI-ProteinID:  XP_008410911 LinkDB All DBs Position LG6:31184628..31185328 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGKCNCGGSCTCENCSCKSCKKSCCSCCPSGCSKCASGCVCKGKTCDKSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgcgactgcgccaagactggaaaatgtaactgcggaggttcctgcacctgc gagaactgctcctgcaaatcctgcaagaaaagttgctgctcttgctgcccatcaggctgc agtaaatgcgcctctggctgcgtgtgcaaagggaagacctgcgacaagagctgctgtcag tga

DBGET integrated database retrieval system